Solution structure of Human Pax8 Paired Box Domain
MPHNSIRSGH GGLNQLGGAF VNGRPLPEVV RQRIVDLAHQ GVRPCDISRQ LRVSHGCVSK ILGRYYETGS IRPGVIGGSK PKVATPKVVE KIGDYKRQNP TMFAWEIRDR LLAEGVCDND TVPSVSSINR IIRTKVQQPF NLPMDSGAPG GGSHHHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 83.4 % (1506 of 1806) | 82.2 % (779 of 948) | 82.6 % (575 of 696) | 93.8 % (152 of 162) |
Backbone | 88.4 % (822 of 930) | 92.0 % (299 of 325) | 83.6 % (383 of 458) | 95.2 % (140 of 147) |
Sidechain | 80.2 % (815 of 1016) | 77.0 % (480 of 623) | 85.4 % (323 of 378) | 80.0 % (12 of 15) |
Aromatic | 47.2 % (50 of 106) | 49.1 % (26 of 53) | 44.2 % (23 of 52) | 100.0 % (1 of 1) |
Methyl | 88.9 % (144 of 162) | 86.4 % (70 of 81) | 91.4 % (74 of 81) |
1. Pax8 Paired Box Domain
MPHNSIRSGH GGLNQLGGAF VNGRPLPEVV RQRIVDLAHQ GVRPCDISRQ LRVSHGCVSK ILGRYYETGS IRPGVIGGSK PKVATPKVVE KIGDYKRQNP TMFAWEIRDR LLAEGVCDND TVPSVSSINR IIRTKVQQPF NLPMDSGAPG GGSHHHHHHSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.00 (±0.1) K, pH 6.2 (±0.1), Details DTT was added for maintaining Pax8 in reduced state. Oxidation leads to polymerization and precipitation.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Pax8 Paired Box Domain | [U-100% 13C; U-100% 15N] | 0.9 (±0.1) mM | |
2 | DSS | natural abundance | 40 (±5.0) uM | |
3 | sodium phosphate | natural abundance | 50 (±5.0) mM | |
4 | sodium azide | natural abundance | 0.1 (±0.05) % | |
5 | DTT | [U-100% 2H] | 15 (±2.0) mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker Avance 2 - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.00 (±0.1) K, pH 6.2 (±0.1), Details DTT was added for maintaining Pax8 in reduced state. Oxidation leads to polymerization and precipitation.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Pax8 Paired Box Domain | [U-100% 13C; U-100% 15N] | 0.9 (±0.1) mM | |
2 | DSS | natural abundance | 40 (±5.0) uM | |
3 | sodium phosphate | natural abundance | 50 (±5.0) mM | |
4 | sodium azide | natural abundance | 0.1 (±0.05) % | |
5 | DTT | [U-100% 2H] | 15 (±2.0) mM |
Bruker Avance 2 - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.00 (±0.1) K, pH 6.2 (±0.1), Details DTT was added for maintaining Pax8 in reduced state. Oxidation leads to polymerization and precipitation.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Pax8 Paired Box Domain | [U-100% 13C; U-100% 15N] | 0.9 (±0.1) mM | |
2 | DSS | natural abundance | 40 (±5.0) uM | |
3 | sodium phosphate | natural abundance | 50 (±5.0) mM | |
4 | sodium azide | natural abundance | 0.1 (±0.05) % | |
5 | DTT | [U-100% 2H] | 15 (±2.0) mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.00 (±0.1) K, pH 6.2 (±0.1), Details DTT was added for maintaining Pax8 in reduced state. Oxidation leads to polymerization and precipitation.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Pax8 Paired Box Domain | [U-100% 13C; U-100% 15N] | 0.9 (±0.1) mM | |
2 | DSS | natural abundance | 40 (±5.0) uM | |
3 | sodium phosphate | natural abundance | 50 (±5.0) mM | |
4 | sodium azide | natural abundance | 0.1 (±0.05) % | |
5 | DTT | [U-100% 2H] | 15 (±2.0) mM |
Bruker Avance 2 - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.00 (±0.1) K, pH 6.2 (±0.1), Details DTT was added for maintaining Pax8 in reduced state. Oxidation leads to polymerization and precipitation.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Pax8 Paired Box Domain | [U-100% 13C; U-100% 15N] | 0.9 (±0.1) mM | |
2 | DSS | natural abundance | 40 (±5.0) uM | |
3 | sodium phosphate | natural abundance | 50 (±5.0) mM | |
4 | sodium azide | natural abundance | 0.1 (±0.05) % | |
5 | DTT | [U-100% 2H] | 15 (±2.0) mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.00 (±0.1) K, pH 6.2 (±0.1), Details DTT was added for maintaining Pax8 in reduced state. Oxidation leads to polymerization and precipitation.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Pax8 Paired Box Domain | [U-100% 13C; U-100% 15N] | 0.9 (±0.1) mM | |
2 | DSS | natural abundance | 40 (±5.0) uM | |
3 | sodium phosphate | natural abundance | 50 (±5.0) mM | |
4 | sodium azide | natural abundance | 0.1 (±0.05) % | |
5 | DTT | [U-100% 2H] | 15 (±2.0) mM |
Bruker Avance 2 - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.00 (±0.1) K, pH 6.2 (±0.1), Details DTT was added for maintaining Pax8 in reduced state. Oxidation leads to polymerization and precipitation.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Pax8 Paired Box Domain | [U-100% 13C; U-100% 15N] | 0.9 (±0.1) mM | |
2 | DSS | natural abundance | 40 (±5.0) uM | |
3 | sodium phosphate | natural abundance | 50 (±5.0) mM | |
4 | sodium azide | natural abundance | 0.1 (±0.05) % | |
5 | DTT | [U-100% 2H] | 15 (±2.0) mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.00 (±0.1) K, pH 6.2 (±0.1), Details DTT was added for maintaining Pax8 in reduced state. Oxidation leads to polymerization and precipitation.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Pax8 Paired Box Domain | [U-100% 13C; U-100% 15N] | 0.9 (±0.1) mM | |
2 | DSS | natural abundance | 40 (±5.0) uM | |
3 | sodium phosphate | natural abundance | 50 (±5.0) mM | |
4 | sodium azide | natural abundance | 0.1 (±0.05) % | |
5 | DTT | [U-100% 2H] | 15 (±2.0) mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.00 (±0.1) K, pH 6.2 (±0.1), Details DTT was added for maintaining Pax8 in reduced state. Oxidation leads to polymerization and precipitation.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Pax8 Paired Box Domain | [U-100% 13C; U-100% 15N] | 0.9 (±0.1) mM | |
2 | DSS | natural abundance | 40 (±5.0) uM | |
3 | sodium phosphate | natural abundance | 50 (±5.0) mM | |
4 | sodium azide | natural abundance | 0.1 (±0.05) % | |
5 | DTT | [U-100% 2H] | 15 (±2.0) mM |
Bruker Avance 2 - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.00 (±0.1) K, pH 6.2 (±0.1), Details DTT was added for maintaining Pax8 in reduced state. Oxidation leads to polymerization and precipitation.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Pax8 Paired Box Domain | [U-100% 13C; U-100% 15N] | 0.9 (±0.1) mM | |
2 | DSS | natural abundance | 40 (±5.0) uM | |
3 | sodium phosphate | natural abundance | 50 (±5.0) mM | |
4 | sodium azide | natural abundance | 0.1 (±0.05) % | |
5 | DTT | [U-100% 2H] | 15 (±2.0) mM |
Bruker Avance 2 - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.00 (±0.1) K, pH 6.2 (±0.1), Details DTT was added for maintaining Pax8 in reduced state. Oxidation leads to polymerization and precipitation.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Pax8 Paired Box Domain | [U-100% 13C; U-100% 15N] | 0.9 (±0.1) mM | |
2 | DSS | natural abundance | 40 (±5.0) uM | |
3 | sodium phosphate | natural abundance | 50 (±5.0) mM | |
4 | sodium azide | natural abundance | 0.1 (±0.05) % | |
5 | DTT | [U-100% 2H] | 15 (±2.0) mM |
Bruker Avance 2 - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.00 (±0.1) K, pH 6.2 (±0.1), Details DTT was added for maintaining Pax8 in reduced state. Oxidation leads to polymerization and precipitation.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Pax8 Paired Box Domain | [U-100% 13C; U-100% 15N] | 0.9 (±0.1) mM | |
2 | DSS | natural abundance | 40 (±5.0) uM | |
3 | sodium phosphate | natural abundance | 50 (±5.0) mM | |
4 | sodium azide | natural abundance | 0.1 (±0.05) % | |
5 | DTT | [U-100% 2H] | 15 (±2.0) mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.00 (±0.1) K, pH 6.2 (±0.1), Details DTT was added for maintaining Pax8 in reduced state. Oxidation leads to polymerization and precipitation.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Pax8 Paired Box Domain | [U-100% 13C; U-100% 15N] | 0.9 (±0.1) mM | |
2 | DSS | natural abundance | 40 (±5.0) uM | |
3 | sodium phosphate | natural abundance | 50 (±5.0) mM | |
4 | sodium azide | natural abundance | 0.1 (±0.05) % | |
5 | DTT | [U-100% 2H] | 15 (±2.0) mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.00 (±0.1) K, pH 6.2 (±0.1), Details DTT was added for maintaining Pax8 in reduced state. Oxidation leads to polymerization and precipitation.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Pax8 Paired Box Domain | [U-100% 13C; U-100% 15N] | 0.9 (±0.1) mM | |
2 | DSS | natural abundance | 40 (±5.0) uM | |
3 | sodium phosphate | natural abundance | 50 (±5.0) mM | |
4 | sodium azide | natural abundance | 0.1 (±0.05) % | |
5 | DTT | [U-100% 2H] | 15 (±2.0) mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_15693_2k27.nef |
Input source #2: Coordindates | 2k27.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNP |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNP -------110-------120-------130-------140-------150--------- TMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSGAPGGGSHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| TMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSGAPGGGSHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 159 | 0 | 0 | 100.0 |
Content subtype: combined_15693_2k27.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNP ||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..HNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVR.CDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNP --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150--------- TMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSGAPGGGSHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||| TMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSGAPGGG -------110-------120-------130-------140-------150--
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
68 | THR | HG1 | 4.76 |
85 | THR | HG1 | 4.75 |
101 | THR | HG1 | 4.72 |
105 | TRP | CD2 | 127.29 |
117 | CYS | HG | 1.91 |
121 | THR | HG1 | 4.76 |
134 | THR | HG1 | 4.76 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 948 | 753 | 79.4 |
13C chemical shifts | 696 | 557 | 80.0 |
15N chemical shifts | 176 | 151 | 85.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 325 | 294 | 90.5 |
13C chemical shifts | 318 | 241 | 75.8 |
15N chemical shifts | 147 | 139 | 94.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 623 | 459 | 73.7 |
13C chemical shifts | 378 | 316 | 83.6 |
15N chemical shifts | 29 | 12 | 41.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 84 | 72 | 85.7 |
13C chemical shifts | 84 | 73 | 86.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 53 | 24 | 45.3 |
13C chemical shifts | 52 | 22 | 42.3 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNP | | ||||||||||| |||||||||||||||||||| ||||||||||| ||||||||||||||||||||| ||||||| |||||||||||||| ......R..H.GLNQLGGAFVN.RPLPEVVRQRIVDLAHQGVR.CDISRQLRVSH.CVSKILGRYYETGSIRPGVIG.SKPKVAT.KVVEKIGDYKRQNP --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150--------- TMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSGAPGGGSHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||| TMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSGAPG -------110-------120-------130-------140-------150
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNP | | ||||| ||||||||||||||||||||||||| ||||||||||| |||||||||||||||| ||||||| |||| |||||||||||||| ......R..H..LNQLG.AFVNGRPLPEVVRQRIVDLAHQGVR.CDISRQLRVSH.CVSKILGRYYETGSIR.GVIGGSK.KVAT.KVVEKIGDYKRQNP --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150--------- TMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSGAPGGGSHHHHHH |||||||||||||||||||||||||||||||||||||||||| | ||||||| TMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNL.M.SGAPGGG -------110-------120-------130-------140-------150--