Solution NMR structure of the chromobox protein homolog 4
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 87.5 % (673 of 769) | 86.6 % (356 of 411) | 88.7 % (259 of 292) | 87.9 % (58 of 66) |
Backbone | 90.1 % (319 of 354) | 89.2 % (107 of 120) | 90.4 % (160 of 177) | 91.2 % (52 of 57) |
Sidechain | 86.7 % (409 of 472) | 85.6 % (249 of 291) | 89.5 % (154 of 172) | 66.7 % (6 of 9) |
Aromatic | 73.7 % (56 of 76) | 84.2 % (32 of 38) | 62.9 % (22 of 35) | 66.7 % (2 of 3) |
Methyl | 92.6 % (50 of 54) | 85.2 % (23 of 27) | 100.0 % (27 of 27) |
1. cbx4
GSEHVFAVES IEKKRIRKGR VEYLVKWRGW SPKYNTWEPE ENILDPRLLI AFQNRERQEQSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | phosphate | natural abundance | 0.5 mM | |
2 | phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | DTT | natural abundance | 2 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | phosphate | natural abundance | 0.5 mM | |
2 | phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | DTT | natural abundance | 2 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | phosphate | natural abundance | 0.5 mM | |
2 | phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | DTT | natural abundance | 2 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | phosphate | natural abundance | 0.5 mM | |
2 | phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | DTT | natural abundance | 2 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | phosphate | natural abundance | 0.5 mM | |
2 | phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | DTT | natural abundance | 2 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | phosphate | natural abundance | 0.5 mM | |
2 | phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | DTT | natural abundance | 2 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | phosphate | natural abundance | 0.5 mM | |
2 | phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | DTT | natural abundance | 2 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | phosphate | natural abundance | 0.5 mM | |
2 | phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | DTT | natural abundance | 2 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | phosphate | natural abundance | 0.5 mM | |
2 | phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | DTT | natural abundance | 2 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | phosphate | natural abundance | 0.5 mM | |
2 | phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | DTT | natural abundance | 2 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | phosphate | natural abundance | 0.5 mM | |
2 | phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | DTT | natural abundance | 2 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | phosphate | natural abundance | 0.5 mM | |
2 | phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | DTT | natural abundance | 2 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_15695_2k28.nef |
Input source #2: Coordindates | 2k28.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60 GSEHVFAVESIEKKRIRKGRVEYLVKWRGWSPKYNTWEPEENILDPRLLIAFQNRERQEQ |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSEHVFAVESIEKKRIRKGRVEYLVKWRGWSPKYNTWEPEENILDPRLLIAFQNRERQEQ
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 60 | 0 | 0 | 100.0 |
Content subtype: combined_15695_2k28.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60 GSEHVFAVESIEKKRIRKGRVEYLVKWRGWSPKYNTWEPEENILDPRLLIAFQNRERQEQ ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSEHVFAVESIEKKRIRKGRVEYLVKWRGWSPKYNTWEPEENILDPRLLIAFQNRERQE --------10--------20--------30--------40--------50---------
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 411 | 375 | 91.2 |
13C chemical shifts | 292 | 262 | 89.7 |
15N chemical shifts | 73 | 56 | 76.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 120 | 111 | 92.5 |
13C chemical shifts | 120 | 108 | 90.0 |
15N chemical shifts | 57 | 50 | 87.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 291 | 264 | 90.7 |
13C chemical shifts | 172 | 154 | 89.5 |
15N chemical shifts | 16 | 6 | 37.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 27 | 27 | 100.0 |
13C chemical shifts | 27 | 27 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 38 | 32 | 84.2 |
13C chemical shifts | 35 | 22 | 62.9 |
15N chemical shifts | 3 | 2 | 66.7 |
Distance restraints
--------10--------20--------30--------40--------50--------60 GSEHVFAVESIEKKRIRKGRVEYLVKWRGWSPKYNTWEPEENILDPRLLIAFQNRERQEQ ||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..EHVFAVESIEKKRIRKGRVEYLVKWRGWSPKYNTWEPEENILDPRLLIAFQNRERQE --------10--------20--------30--------40--------50---------
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60 GSEHVFAVESIEKKRIRKGRVEYLVKWRGWSPKYNTWEPEENILDPRLLIAFQNRERQEQ |||||| ||||||||||||||||||||||||||||||| |||||||||||| ...HVFAVE..EKKRIRKGRVEYLVKWRGWSPKYNTWEPEEN...PRLLIAFQNRER --------10--------20--------30--------40--------50-------