Bpp3783_115-220
KQQLQEHAPS HANLDVKWLD GLRAGSMALQ GDVKVWMQNL EDLHTRRPDE FTARLQQSTD ALYSHLEAQW AKQHGTPPTA SDVVGMPQWQ EYTAMLRERF AGLDTI
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 74.3 % (919 of 1237) | 71.4 % (460 of 644) | 76.4 % (363 of 475) | 81.4 % (96 of 118) |
Backbone | 86.1 % (539 of 626) | 85.0 % (181 of 213) | 86.9 % (271 of 312) | 86.1 % (87 of 101) |
Sidechain | 65.4 % (465 of 711) | 64.0 % (276 of 431) | 68.8 % (181 of 263) | 47.1 % (8 of 17) |
Aromatic | 12.5 % (13 of 104) | 21.2 % (11 of 52) | 0.0 % (0 of 48) | 50.0 % (2 of 4) |
Methyl | 86.1 % (93 of 108) | 85.2 % (46 of 54) | 87.0 % (47 of 54) |
1. BPP3783 115-120
KQQLQEHAPS HANLDVKWLD GLRAGSMALQ GDVKVWMQNL EDLHTRRPDE FTARLQQSTD ALYSHLEAQW AKQHGTPPTA SDVVGMPQWQ EYTAMLRERF AGLDTISolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7, Details pH 7.7 1x protease inhibitor cocktail
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.5 (±0.2) mM | |
2 | NaCl | natural abundance | 500 (±10.0) mM | |
3 | TRIS | natural abundance | 10 (±1.0) mM | |
4 | Zn++ | natural abundance | 10 (±1.0) uM | |
5 | Benzamidine | natural abundance | 1 (±0.2) mM | |
6 | NaN3 | natural abundance | 0.01 (±0.01) % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7, Details pH 7.7 1x protease inhibitor cocktail
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.5 (±0.2) mM | |
2 | NaCl | natural abundance | 500 (±10.0) mM | |
3 | TRIS | natural abundance | 10 (±1.0) mM | |
4 | Zn++ | natural abundance | 10 (±1.0) uM | |
5 | Benzamidine | natural abundance | 1 (±0.2) mM | |
6 | NaN3 | natural abundance | 0.01 (±0.01) % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7, Details pH 7.7 1x protease inhibitor cocktail
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.5 (±0.2) mM | |
2 | NaCl | natural abundance | 500 (±10.0) mM | |
3 | TRIS | natural abundance | 10 (±1.0) mM | |
4 | Zn++ | natural abundance | 10 (±1.0) uM | |
5 | Benzamidine | natural abundance | 1 (±0.2) mM | |
6 | NaN3 | natural abundance | 0.01 (±0.01) % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7, Details pH 7.7 1x protease inhibitor cocktail
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.5 (±0.2) mM | |
2 | NaCl | natural abundance | 500 (±10.0) mM | |
3 | TRIS | natural abundance | 10 (±1.0) mM | |
4 | Zn++ | natural abundance | 10 (±1.0) uM | |
5 | Benzamidine | natural abundance | 1 (±0.2) mM | |
6 | NaN3 | natural abundance | 0.01 (±0.01) % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7, Details pH 7.7 1x protease inhibitor cocktail
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.5 (±0.2) mM | |
2 | NaCl | natural abundance | 500 (±10.0) mM | |
3 | TRIS | natural abundance | 10 (±1.0) mM | |
4 | Zn++ | natural abundance | 10 (±1.0) uM | |
5 | Benzamidine | natural abundance | 1 (±0.2) mM | |
6 | NaN3 | natural abundance | 0.01 (±0.01) % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7, Details pH 7.7 1x protease inhibitor cocktail
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.5 (±0.2) mM | |
2 | NaCl | natural abundance | 500 (±10.0) mM | |
3 | TRIS | natural abundance | 10 (±1.0) mM | |
4 | Zn++ | natural abundance | 10 (±1.0) uM | |
5 | Benzamidine | natural abundance | 1 (±0.2) mM | |
6 | NaN3 | natural abundance | 0.01 (±0.01) % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7, Details pH 7.7 1x protease inhibitor cocktail
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.5 (±0.2) mM | |
2 | NaCl | natural abundance | 500 (±10.0) mM | |
3 | TRIS | natural abundance | 10 (±1.0) mM | |
4 | Zn++ | natural abundance | 10 (±1.0) uM | |
5 | Benzamidine | natural abundance | 1 (±0.2) mM | |
6 | NaN3 | natural abundance | 0.01 (±0.01) % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7, Details pH 7.7 1x protease inhibitor cocktail
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.5 (±0.2) mM | |
2 | NaCl | natural abundance | 500 (±10.0) mM | |
3 | TRIS | natural abundance | 10 (±1.0) mM | |
4 | Zn++ | natural abundance | 10 (±1.0) uM | |
5 | Benzamidine | natural abundance | 1 (±0.2) mM | |
6 | NaN3 | natural abundance | 0.01 (±0.01) % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7, Details pH 7.7 1x protease inhibitor cocktail
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.5 (±0.2) mM | |
2 | NaCl | natural abundance | 500 (±10.0) mM | |
3 | TRIS | natural abundance | 10 (±1.0) mM | |
4 | Zn++ | natural abundance | 10 (±1.0) uM | |
5 | Benzamidine | natural abundance | 1 (±0.2) mM | |
6 | NaN3 | natural abundance | 0.01 (±0.01) % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7, Details pH 7.7 1x protease inhibitor cocktail
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.5 (±0.2) mM | |
2 | NaCl | natural abundance | 500 (±10.0) mM | |
3 | TRIS | natural abundance | 10 (±1.0) mM | |
4 | Zn++ | natural abundance | 10 (±1.0) uM | |
5 | Benzamidine | natural abundance | 1 (±0.2) mM | |
6 | NaN3 | natural abundance | 0.01 (±0.01) % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7, Details pH 7.7 1x protease inhibitor cocktail
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.5 (±0.2) mM | |
2 | NaCl | natural abundance | 500 (±10.0) mM | |
3 | TRIS | natural abundance | 10 (±1.0) mM | |
4 | Zn++ | natural abundance | 10 (±1.0) uM | |
5 | Benzamidine | natural abundance | 1 (±0.2) mM | |
6 | NaN3 | natural abundance | 0.01 (±0.01) % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7, Details pH 7.7 1x protease inhibitor cocktail
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.5 (±0.2) mM | |
2 | NaCl | natural abundance | 500 (±10.0) mM | |
3 | TRIS | natural abundance | 10 (±1.0) mM | |
4 | Zn++ | natural abundance | 10 (±1.0) uM | |
5 | Benzamidine | natural abundance | 1 (±0.2) mM | |
6 | NaN3 | natural abundance | 0.01 (±0.01) % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7, Details pH 7.7 1x protease inhibitor cocktail
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.5 (±0.2) mM | |
2 | NaCl | natural abundance | 500 (±10.0) mM | |
3 | TRIS | natural abundance | 10 (±1.0) mM | |
4 | Zn++ | natural abundance | 10 (±1.0) uM | |
5 | Benzamidine | natural abundance | 1 (±0.2) mM | |
6 | NaN3 | natural abundance | 0.01 (±0.01) % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7, Details pH 7.7 1x protease inhibitor cocktail
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.5 (±0.2) mM | |
2 | NaCl | natural abundance | 500 (±10.0) mM | |
3 | TRIS | natural abundance | 10 (±1.0) mM | |
4 | Zn++ | natural abundance | 10 (±1.0) uM | |
5 | Benzamidine | natural abundance | 1 (±0.2) mM | |
6 | NaN3 | natural abundance | 0.01 (±0.01) % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Dihedral angle restraints | combined_15746_2jpf.nef |
Input source #2: Coordindates | 2jpf.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-----------------------------10--------20--------30--------40--------50--------60--------70--------8 MGSSHHHHHHSSGRENLYFQGKQQLQEHAPSHANLDVKWLDGLRAGSMALQGDVKVWMQNLEDLHTRRPDEFTARLQQSTDALYSHLEAQWAKQHGTPPT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGSSHHHHHHSSGRENLYFQGKQQLQEHAPSHANLDVKWLDGLRAGSMALQGDVKVWMQNLEDLHTRRPDEFTARLQQSTDALYSHLEAQWAKQHGTPPT --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 0--------90-------100------ ASDVVGMPQWQEYTAMLRERFAGLDTI ||||||||||||||||||||||||||| ASDVVGMPQWQEYTAMLRERFAGLDTI -------110-------120-------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 127 | 0 | 0 | 100.0 |
Content subtype: combined_15746_2jpf.nef
Assigned chemical shifts
-----------------------------10--------20--------30--------40--------50--------60--------70--------8 MGSSHHHHHHSSGRENLYFQGKQQLQEHAPSHANLDVKWLDGLRAGSMALQGDVKVWMQNLEDLHTRRPDEFTARLQQSTDALYSHLEAQWAKQHGTPPT ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...............................HANLDVKWLDGLRAGSMALQGDVKVWMQNLEDLHTRRPDEFTARLQQSTDALYSHLEAQWAKQHGTPPT 0--------90-------100------ ASDVVGMPQWQEYTAMLRERFAGLDTI ||||||||||||||||||||||||||| ASDVVGMPQWQEYTAMLRERFAGLDTI
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 765 | 466 | 60.9 |
13C chemical shifts | 565 | 359 | 63.5 |
15N chemical shifts | 148 | 94 | 63.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 258 | 184 | 71.3 |
13C chemical shifts | 254 | 181 | 71.3 |
15N chemical shifts | 122 | 86 | 70.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 507 | 282 | 55.6 |
13C chemical shifts | 311 | 178 | 57.2 |
15N chemical shifts | 26 | 8 | 30.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 61 | 50 | 82.0 |
13C chemical shifts | 61 | 50 | 82.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 73 | 10 | 13.7 |
13C chemical shifts | 69 | 0 | 0.0 |
15N chemical shifts | 4 | 2 | 50.0 |
Dihedral angle restraints
-----------------------------10--------20--------30--------40--------50--------60--------70--------8 MGSSHHHHHHSSGRENLYFQGKQQLQEHAPSHANLDVKWLDGLRAGSMALQGDVKVWMQNLEDLHTRRPDEFTARLQQSTDALYSHLEAQWAKQHGTPPT |||||||||||||||||||||||||||||||||||||||||||||| | ..................................................QGDVKVWMQNLEDLHTRRPDEFTARLQQSTDALYSHLEAQWAKQHG...T -----------------------------10--------20--------30--------40--------50--------60--------70--------8 0--------90-------100------ ASDVVGMPQWQEYTAMLRERFAGLDTI |||||| |||||||||||||| ASDVVG.PQWQEYTAMLRERF 0--------90-------100