CopR Repressor Structure
MSYYHHHHHH DYDIPTTENL YFQGAMNEVE FNVSNAELIV MRVIWSLGEA RVDEIYAQIP QELEWSLATV KTLLGRLVKK EMLSTEKEGR KFVYRPLME
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 55.5 % (670 of 1207) | 56.5 % (354 of 626) | 52.9 % (252 of 476) | 61.0 % (64 of 105) |
Backbone | 60.4 % (355 of 588) | 62.3 % (124 of 199) | 58.7 % (172 of 293) | 61.5 % (59 of 96) |
Sidechain | 52.1 % (372 of 714) | 53.9 % (230 of 427) | 49.3 % (137 of 278) | 55.6 % (5 of 9) |
Aromatic | 16.7 % (21 of 126) | 30.2 % (19 of 63) | 0.0 % (0 of 61) | 100.0 % (2 of 2) |
Methyl | 75.0 % (84 of 112) | 75.0 % (42 of 56) | 75.0 % (42 of 56) |
1. CopR-NTD
MSYYHHHHHH DYDIPTTENL YFQGAMNEVE FNVSNAELIV MRVIWSLGEA RVDEIYAQIP QELEWSLATV KTLLGRLVKK EMLSTEKEGR KFVYRPLMESolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CopR-NTD | [U-99% 13C; U-99% 15N] | 0.2 (±0.05) mM | |
2 | NaPi | 50 mM | ||
3 | NaCl | 100 mM | ||
4 | H2O | natural abundance | 90 % | |
5 | D2O | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | dioxane | methylene carbons | 69.3 ppm | external | direct | 1.0 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | dioxane | methylene carbons | 69.3 ppm | external | direct | 1.0 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | dioxane | methylene carbons | 69.3 ppm | external | direct | 1.0 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | dioxane | methylene carbons | 69.3 ppm | external | direct | 1.0 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Pressure 1 atm, Temperature 298 K, pH 7.5
Experiment name 2D 1H-15N HSQC
Pressure 1 atm, Temperature 298 K, pH 7.5
Experiment name 2D 1H-15N HSQC
Pressure 1 atm, Temperature 298 K, pH 7.5
Experiment name 2D 1H-15N HSQC
Pressure 1 atm, Temperature 298 K, pH 7.5
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CopR-NTD | [U-99% 13C; U-99% 15N] | 0.2 (±0.05) mM | |
2 | NaPi | 50 mM | ||
3 | NaCl | 100 mM | ||
4 | H2O | natural abundance | 90 % | |
5 | D2O | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CopR-NTD | [U-99% 13C; U-99% 15N] | 0.2 (±0.05) mM | |
2 | NaPi | 50 mM | ||
3 | NaCl | 100 mM | ||
4 | H2O | natural abundance | 90 % | |
5 | D2O | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CopR-NTD | [U-99% 13C; U-99% 15N] | 0.2 (±0.05) mM | |
2 | NaPi | 50 mM | ||
3 | NaCl | 100 mM | ||
4 | H2O | natural abundance | 90 % | |
5 | D2O | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CopR-NTD | [U-99% 13C; U-99% 15N] | 0.2 (±0.05) mM | |
2 | NaPi | 50 mM | ||
3 | NaCl | 100 mM | ||
4 | H2O | natural abundance | 90 % | |
5 | D2O | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CopR-NTD | [U-99% 13C; U-99% 15N] | 0.2 (±0.05) mM | |
2 | NaPi | 50 mM | ||
3 | NaCl | 100 mM | ||
4 | H2O | natural abundance | 90 % | |
5 | D2O | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CopR-NTD | [U-99% 13C; U-99% 15N] | 0.2 (±0.05) mM | |
2 | NaPi | 50 mM | ||
3 | NaCl | 100 mM | ||
4 | H2O | natural abundance | 90 % | |
5 | D2O | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CopR-NTD | [U-99% 13C; U-99% 15N] | 0.2 (±0.05) mM | |
2 | NaPi | 50 mM | ||
3 | NaCl | 100 mM | ||
4 | H2O | natural abundance | 90 % | |
5 | D2O | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CopR-NTD | [U-99% 13C; U-99% 15N] | 0.2 (±0.05) mM | |
2 | NaPi | 50 mM | ||
3 | NaCl | 100 mM | ||
4 | H2O | natural abundance | 90 % | |
5 | D2O | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CopR-NTD | [U-99% 13C; U-99% 15N] | 0.2 (±0.05) mM | |
2 | NaPi | 50 mM | ||
3 | NaCl | 100 mM | ||
4 | H2O | natural abundance | 90 % | |
5 | D2O | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CopR-NTD | [U-99% 13C; U-99% 15N] | 0.2 (±0.05) mM | |
2 | NaPi | 50 mM | ||
3 | NaCl | 100 mM | ||
4 | H2O | natural abundance | 90 % | |
5 | D2O | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_15793_2k4b.nef |
Input source #2: Coordindates | 2k4b.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90--------- MSYYHHHHHHDYDIPTTENLYFQGAMNEVEFNVSNAELIVMRVIWSLGEARVDEIYAQIPQELEWSLATVKTLLGRLVKKEMLSTEKEGRKFVYRPLME ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MSYYHHHHHHDYDIPTTENLYFQGAMNEVEFNVSNAELIVMRVIWSLGEARVDEIYAQIPQELEWSLATVKTLLGRLVKKEMLSTEKEGRKFVYRPLME
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 99 | 0 | 0 | 100.0 |
Content subtype: combined_15793_2k4b.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90--------- MSYYHHHHHHDYDIPTTENLYFQGAMNEVEFNVSNAELIVMRVIWSLGEARVDEIYAQIPQELEWSLATVKTLLGRLVKKEMLSTEKEGRKFVYRPLME | || ||||||||||||||||||||||||||||||||||||||||||||||| ||||||| ...................................A..IV.RVIWSLGEARVDEIYAQIPQELEWSLATVKTLLGRLVKKEMLSTEKE..KFVYRPL --------10--------20--------30--------40--------50--------60--------70--------80--------90-------
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 626 | 323 | 51.6 |
13C chemical shifts | 476 | 230 | 48.3 |
15N chemical shifts | 110 | 52 | 47.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 199 | 106 | 53.3 |
13C chemical shifts | 198 | 100 | 50.5 |
15N chemical shifts | 96 | 48 | 50.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 427 | 217 | 50.8 |
13C chemical shifts | 278 | 130 | 46.8 |
15N chemical shifts | 14 | 4 | 28.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 61 | 42 | 68.9 |
13C chemical shifts | 61 | 42 | 68.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 63 | 19 | 30.2 |
13C chemical shifts | 61 | 0 | 0.0 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90--------- MSYYHHHHHHDYDIPTTENLYFQGAMNEVEFNVSNAELIVMRVIWSLGEARVDEIYAQIPQELEWSLATVKTLLGRLVKKEMLSTEKEGRKFVYRPLME | || |||||||||||||||||||||||||||||||||||||||||||||| |||||| | ...................................A..IV..VIWSLGEARVDEIYAQIPQELEWSLATVKTLLGRLVKKEMLSTEKE.RKFVYR.L --------10--------20--------30--------40--------50--------60--------70--------80--------90-------
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90--------- MSYYHHHHHHDYDIPTTENLYFQGAMNEVEFNVSNAELIVMRVIWSLGEARVDEIYAQIPQELEWSLATVKTLLGRLVKKEMLSTEKEGRKFVYRPLME |||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||| ..................................NAELIVMRVIWSLGEARVDEIYAQIPQELEWSLATVKTLLGRLVKK.MLSTEKEGRKFVYRP --------10--------20--------30--------40--------50--------60--------70--------80--------90------