ArsR DNA Binding Domain
MRGSHHHHHH GSEEVSEPGD ANIFRVDKDS REVYMHEKKL DLTRAEYEIL SLLISKKGYV FSRESIAIES ESINPESSNK SIDVIIGRLR SKIEKNPKQP QYIISVRGIG YKLEY
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 73.8 % (1013 of 1373) | 78.0 % (565 of 724) | 64.8 % (345 of 532) | 88.0 % (103 of 117) |
Backbone | 77.1 % (526 of 682) | 89.7 % (209 of 233) | 63.6 % (215 of 338) | 91.9 % (102 of 111) |
Sidechain | 72.7 % (581 of 799) | 72.5 % (356 of 491) | 74.2 % (224 of 302) | 16.7 % (1 of 6) |
Aromatic | 14.6 % (14 of 96) | 29.2 % (14 of 48) | 0.0 % (0 of 48) | |
Methyl | 95.5 % (107 of 112) | 94.6 % (53 of 56) | 96.4 % (54 of 56) |
1. ArsR
MRGSHHHHHH GSEEVSEPGD ANIFRVDKDS REVYMHEKKL DLTRAEYEIL SLLISKKGYV FSRESIAIES ESINPESSNK SIDVIIGRLR SKIEKNPKQP QYIISVRGIG YKLEYSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | NaCl | 0.5 M |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.7 ppm | internal | indirect | 0.251458 |
1H | water | protons | 4.7 ppm | internal | direct | 1.0 |
15N | water | protons | 4.7 ppm | internal | indirect | 0.1013406 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.7 ppm | internal | indirect | 0.251458 |
1H | water | protons | 4.7 ppm | internal | direct | 1.0 |
15N | water | protons | 4.7 ppm | internal | indirect | 0.1013406 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.7 ppm | internal | indirect | 0.251458 |
1H | water | protons | 4.7 ppm | internal | direct | 1.0 |
15N | water | protons | 4.7 ppm | internal | indirect | 0.1013406 |
Bruker Avance - 600 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | NaCl | 0.5 M |
Bruker Avance - 600 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | NaCl | 0.5 M |
Bruker Avance - 600 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | NaCl | 0.5 M |
Bruker Avance - 600 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | NaCl | 0.5 M |
Bruker Avance - 600 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | NaCl | 0.5 M |
Bruker Avance - 600 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | NaCl | 0.5 M |
Bruker Avance - 600 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | NaCl | 0.5 M |
Bruker Avance - 600 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | NaCl | 0.5 M |
Bruker Avance - 600 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | NaCl | 0.5 M |
Bruker Avance - 600 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | NaCl | 0.5 M |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_15801_2k4j.nef |
Input source #2: Coordindates | 2k4j.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MRGSHHHHHHGSEEVSEPGDANIFRVDKDSREVYMHEKKLDLTRAEYEILSLLISKKGYVFSRESIAIESESINPESSNKSIDVIIGRLRSKIEKNPKQP |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MRGSHHHHHHGSEEVSEPGDANIFRVDKDSREVYMHEKKLDLTRAEYEILSLLISKKGYVFSRESIAIESESINPESSNKSIDVIIGRLRSKIEKNPKQP -------110----- QYIISVRGIGYKLEY ||||||||||||||| QYIISVRGIGYKLEY
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 115 | 0 | 0 | 100.0 |
Content subtype: combined_15801_2k4j.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MRGSHHHHHHGSEEVSEPGDANIFRVDKDSREVYMHEKKLDLTRAEYEILSLLISKKGYVFSRESIAIESESINPESSNKSIDVIIGRLRSKIEKNPKQP |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..........GSEEVSEPGDANIFRVDKDSREVYMHEKKLDLTRAEYEILSLLISKKGYVFSRESIAIESESINPESSNKSIDVIIGRLRSKIEKNPKQP -------110----- QYIISVRGIGYKLEY ||||||||||||||| QYIISVRGIGYKLEY
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 724 | 559 | 77.2 |
13C chemical shifts | 532 | 321 | 60.3 |
15N chemical shifts | 125 | 100 | 80.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 233 | 206 | 88.4 |
13C chemical shifts | 230 | 100 | 43.5 |
15N chemical shifts | 111 | 100 | 90.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 491 | 353 | 71.9 |
13C chemical shifts | 302 | 221 | 73.2 |
15N chemical shifts | 14 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 58 | 56 | 96.6 |
13C chemical shifts | 58 | 53 | 91.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 48 | 14 | 29.2 |
13C chemical shifts | 48 | 0 | 0.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MRGSHHHHHHGSEEVSEPGDANIFRVDKDSREVYMHEKKLDLTRAEYEILSLLISKKGYVFSRESIAIESESINPESSNKSIDVIIGRLRSKIEKNPKQP |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ............EEVSEPGDANIFRVDKDSREVYMHEKKLDLTRAEYEILSLLISKKGYVFSRESIAIESESINPESSNKSIDVIIGRLRSKIEKNPKQP -------110----- QYIISVRGIGYKLEY ||||||||||||||| QYIISVRGIGYKLEY
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MRGSHHHHHHGSEEVSEPGDANIFRVDKDSREVYMHEKKLDLTRAEYEILSLLISKKGYVFSRESIAIESESINPESSNKSIDVIIGRLRSKIEKNPKQP |||||||||| |||||||||||||| |||||||||||||||||||||||||||| | |||||||||||||||||||| || .................PGDANIFRVD.DSREVYMHEKKLDL.RAEYEILSLLISKKGYVFSRESIAIESE.I.PESSNKSIDVIIGRLRSKIE...KQ. -------110----- QYIISVRGIGYKLEY ||||||||||||||| QYIISVRGIGYKLEY
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MRGSHHHHHHGSEEVSEPGDANIFRVDKDSREVYMHEKKLDLTRAEYEILSLLISKKGYVFSRESIAIESESINPESSNKSIDVIIGRLRSKIEKNPKQP | | |||| |||| | | ||||||||||||||| | |||||||||| |||||||||||||||| ..................G.A..FRVD....EVYM..K.L..TRAEYEILSLLISKK.Y.FSRESIAIES..........SIDVIIGRLRSKIEKN.... --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110----- QYIISVRGIGYKLEY | | |||| ...I.V...GYKL -------110---