Solution NMR Structure of M. thermoautotrophicum protein MTH_1000, Northeast Structural Genomics Consortium Target TR8
MGSSHHHHHH SSGLVPRGSH MWNDLAVYII RCSGPGTRVV EVGAGRFLYV SDYIRKHSKV DLVLTDIKPS HGGIVRDDIT SPRMEIYRGA ALIYSIRPPA EIHSSLMRVA DAVGARLIIK PLTGEDIVTE RKMKLVNYGR TYFYEYIAEV RSR
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 88.4 % (1560 of 1764) | 87.7 % (801 of 913) | 88.7 % (623 of 702) | 91.3 % (136 of 149) |
Backbone | 90.3 % (816 of 904) | 90.7 % (283 of 312) | 89.7 % (400 of 446) | 91.1 % (133 of 146) |
Sidechain | 86.9 % (869 of 1000) | 86.2 % (518 of 601) | 87.9 % (348 of 396) | 100.0 % (3 of 3) |
Aromatic | 68.1 % (98 of 144) | 68.1 % (49 of 72) | 67.6 % (48 of 71) | 100.0 % (1 of 1) |
Methyl | 100.0 % (182 of 182) | 100.0 % (91 of 91) | 100.0 % (91 of 91) |
1. TR8 protein
MGSSHHHHHH SSGLVPRGSH MWNDLAVYII RCSGPGTRVV EVGAGRFLYV SDYIRKHSKV DLVLTDIKPS HGGIVRDDIT SPRMEIYRGA ALIYSIRPPA EIHSSLMRVA DAVGARLIIK PLTGEDIVTE RKMKLVNYGR TYFYEYIAEV RSRSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TR8 protein | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | benzamidine | natural abundance | 1 mM | |
5 | DTT | natural abundance | 10 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | TR8 protein | [U-5% 13C; U-100% 15N] | 0.8 mM | |
7 | sodium phosphate | natural abundance | 10 mM | |
8 | sodium chloride | natural abundance | 450 mM | |
9 | benzamidine | natural abundance | 1 mM | |
10 | DTT | natural abundance | 10 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TR8 protein | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | benzamidine | natural abundance | 1 mM | |
5 | DTT | natural abundance | 10 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TR8 protein | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | benzamidine | natural abundance | 1 mM | |
5 | DTT | natural abundance | 10 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TR8 protein | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | benzamidine | natural abundance | 1 mM | |
5 | DTT | natural abundance | 10 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TR8 protein | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | benzamidine | natural abundance | 1 mM | |
5 | DTT | natural abundance | 10 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TR8 protein | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | benzamidine | natural abundance | 1 mM | |
5 | DTT | natural abundance | 10 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TR8 protein | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | benzamidine | natural abundance | 1 mM | |
5 | DTT | natural abundance | 10 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TR8 protein | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | benzamidine | natural abundance | 1 mM | |
5 | DTT | natural abundance | 10 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TR8 protein | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | benzamidine | natural abundance | 1 mM | |
5 | DTT | natural abundance | 10 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TR8 protein | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | benzamidine | natural abundance | 1 mM | |
5 | DTT | natural abundance | 10 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TR8 protein | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | benzamidine | natural abundance | 1 mM | |
5 | DTT | natural abundance | 10 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TR8 protein | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | benzamidine | natural abundance | 1 mM | |
5 | DTT | natural abundance | 10 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | TR8 protein | [U-5% 13C; U-100% 15N] | 0.8 mM | |
7 | sodium phosphate | natural abundance | 10 mM | |
8 | sodium chloride | natural abundance | 450 mM | |
9 | benzamidine | natural abundance | 1 mM | |
10 | DTT | natural abundance | 10 mM |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | TR8 protein | [U-5% 13C; U-100% 15N] | 0.8 mM | |
7 | sodium phosphate | natural abundance | 10 mM | |
8 | sodium chloride | natural abundance | 450 mM | |
9 | benzamidine | natural abundance | 1 mM | |
10 | DTT | natural abundance | 10 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_15804_2k4m.nef |
Input source #2: Coordindates | 2k4m.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGSSHHHHHHSSGLVPRGSHMWNDLAVYIIRCSGPGTRVVEVGAGRFLYVSDYIRKHSKVDLVLTDIKPSHGGIVRDDITSPRMEIYRGAALIYSIRPPA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGSSHHHHHHSSGLVPRGSHMWNDLAVYIIRCSGPGTRVVEVGAGRFLYVSDYIRKHSKVDLVLTDIKPSHGGIVRDDITSPRMEIYRGAALIYSIRPPA -------110-------120-------130-------140-------150--- EIHSSLMRVADAVGARLIIKPLTGEDIVTERKMKLVNYGRTYFYEYIAEVRSR ||||||||||||||||||||||||||||||||||||||||||||||||||||| EIHSSLMRVADAVGARLIIKPLTGEDIVTERKMKLVNYGRTYFYEYIAEVRSR
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 153 | 0 | 0 | 100.0 |
Content subtype: combined_15804_2k4m.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGSSHHHHHHSSGLVPRGSHMWNDLAVYIIRCSGPGTRVVEVGAGRFLYVSDYIRKHSKVDLVLTDIKPSHGGIVRDDITSPRMEIYRGAALIYSIRPPA |||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...........SGLVPRGS.MWNDLAVYIIRCSGPGTRVVEVGAGRFLYVSDYIRKHSKVDLVLTDIKPSHGGIVRDDITSPRMEIYRGAALIYSIRPPA -------110-------120-------130-------140-------150--- EIHSSLMRVADAVGARLIIKPLTGEDIVTERKMKLVNYGRTYFYEYIAEVRSR ||||||||||||||||||||||||||||| ||||||||||||||||||||||| EIHSSLMRVADAVGARLIIKPLTGEDIVT.RKMKLVNYGRTYFYEYIAEVRSR
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
33 | SER | HG | 4.897 |
51 | SER | HG | 5.305 |
87 | TYR | HH | 11.231 |
94 | TYR | HH | 8.428 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 913 | 797 | 87.3 |
13C chemical shifts | 702 | 613 | 87.3 |
15N chemical shifts | 164 | 136 | 82.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 312 | 280 | 89.7 |
13C chemical shifts | 306 | 264 | 86.3 |
15N chemical shifts | 146 | 130 | 89.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 601 | 517 | 86.0 |
13C chemical shifts | 396 | 349 | 88.1 |
15N chemical shifts | 18 | 6 | 33.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 96 | 94 | 97.9 |
13C chemical shifts | 96 | 94 | 97.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 72 | 53 | 73.6 |
13C chemical shifts | 71 | 52 | 73.2 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGSSHHHHHHSSGLVPRGSHMWNDLAVYIIRCSGPGTRVVEVGAGRFLYVSDYIRKHSKVDLVLTDIKPSHGGIVRDDITSPRMEIYRGAALIYSIRPPA |||||| | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...........SGLVPR.S.MWNDLAVYIIRCSGPGTRVVEVGAGRFLYVSDYIRKHSKVDLVLTDIKPSHGGIVRDDITSPRMEIYRGAALIYSIRPPA -------110-------120-------130-------140-------150--- EIHSSLMRVADAVGARLIIKPLTGEDIVTERKMKLVNYGRTYFYEYIAEVRSR ||||||||||||||||||||||||||||| ||||||||||||||||||||||| EIHSSLMRVADAVGARLIIKPLTGEDIVT.RKMKLVNYGRTYFYEYIAEVRSR
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGSSHHHHHHSSGLVPRGSHMWNDLAVYIIRCSGPGTRVVEVGAGRFLYVSDYIRKHSKVDLVLTDIKPSHGGIVRDDITSPRMEIYRGAALIYSIRPPA | |||||||||| || | ||||||| ||||||| |||||| ||||||||||||||||||||||| || |||||||| |||||| |||||| M.SSHHHHHHSS.LV.R.SHMWNDL.VYIIRCS...TRVVEV...RFLYVSDYIRKHSKVDLVLTDIK.SH..IVRDDITS.RMEIYR...LIYSIR... -------110-------120-------130-------140-------150--- EIHSSLMRVADAVGARLIIKPLTGEDIVTERKMKLVNYGRTYFYEYIAEVRSR ||||||||| | | ||||| || |||||||||||||| |||||||| ||||| EIHSSLMRV.D.V..RLIIK.LT.EDIVTERKMKLVNY.RTYFYEYI.EVRSR