Solution structure of uncharacterized protein PA1076 from Pseudomonas aeruginosa. Northeast Structural Genomics Consortium (NESG) target PaT3, Ontario Center for Structural Proteomics target PA1076.
QGHMFEPGHL HLVSLPGLDQ QDINIHIRYE VRQNAESGAY VHFDMDGEID GKPFSDSFEL PRDTAFNFAS DATRVAQKHG LHPKFGAITR VHKEYDAMFE DIRAKLHAHP GEPVDLERII RHEGS
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 89.6 % (1298 of 1448) | 91.0 % (686 of 754) | 89.6 % (509 of 568) | 81.7 % (103 of 126) |
Backbone | 89.0 % (655 of 736) | 90.5 % (229 of 253) | 90.1 % (329 of 365) | 82.2 % (97 of 118) |
Sidechain | 91.1 % (753 of 827) | 91.2 % (457 of 501) | 91.2 % (290 of 318) | 75.0 % (6 of 8) |
Aromatic | 71.6 % (106 of 148) | 75.7 % (56 of 74) | 67.6 % (50 of 74) | |
Methyl | 98.2 % (112 of 114) | 98.2 % (56 of 57) | 98.2 % (56 of 57) |
1. PA1076
QGHMFEPGHL HLVSLPGLDQ QDINIHIRYE VRQNAESGAY VHFDMDGEID GKPFSDSFEL PRDTAFNFAS DATRVAQKHG LHPKFGAITR VHKEYDAMFE DIRAKLHAHP GEPVDLERII RHEGSSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PA1076 | [U-100% 13C; U-100% 15N] | 0.7-1 mM | |
2 | TRIS | [U-2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | sodium azide | natural abundance | 0.01 % | |
5 | benzamidine | natural abundance | 1 mM | |
6 | inhibitor cocktail | natural abundance | 1 na |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker Avance - 800 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PA1076 | [U-100% 13C; U-100% 15N] | 0.7-1 mM | |
2 | TRIS | [U-2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | sodium azide | natural abundance | 0.01 % | |
5 | benzamidine | natural abundance | 1 mM | |
6 | inhibitor cocktail | natural abundance | 1 na |
Bruker Avance - 800 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PA1076 | [U-100% 13C; U-100% 15N] | 0.7-1 mM | |
2 | TRIS | [U-2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | sodium azide | natural abundance | 0.01 % | |
5 | benzamidine | natural abundance | 1 mM | |
6 | inhibitor cocktail | natural abundance | 1 na |
Bruker Avance - 600 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PA1076 | [U-100% 13C; U-100% 15N] | 0.7-1 mM | |
2 | TRIS | [U-2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | sodium azide | natural abundance | 0.01 % | |
5 | benzamidine | natural abundance | 1 mM | |
6 | inhibitor cocktail | natural abundance | 1 na |
Bruker Avance - 500 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PA1076 | [U-100% 13C; U-100% 15N] | 0.7-1 mM | |
2 | TRIS | [U-2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | sodium azide | natural abundance | 0.01 % | |
5 | benzamidine | natural abundance | 1 mM | |
6 | inhibitor cocktail | natural abundance | 1 na |
Bruker Avance - 600 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PA1076 | [U-100% 13C; U-100% 15N] | 0.7-1 mM | |
2 | TRIS | [U-2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | sodium azide | natural abundance | 0.01 % | |
5 | benzamidine | natural abundance | 1 mM | |
6 | inhibitor cocktail | natural abundance | 1 na |
Bruker Avance - 800 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PA1076 | [U-100% 13C; U-100% 15N] | 0.7-1 mM | |
2 | TRIS | [U-2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | sodium azide | natural abundance | 0.01 % | |
5 | benzamidine | natural abundance | 1 mM | |
6 | inhibitor cocktail | natural abundance | 1 na |
Bruker Avance - 500 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PA1076 | [U-100% 13C; U-100% 15N] | 0.7-1 mM | |
2 | TRIS | [U-2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | sodium azide | natural abundance | 0.01 % | |
5 | benzamidine | natural abundance | 1 mM | |
6 | inhibitor cocktail | natural abundance | 1 na |
Bruker Avance - 500 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PA1076 | [U-100% 13C; U-100% 15N] | 0.7-1 mM | |
2 | TRIS | [U-2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | sodium azide | natural abundance | 0.01 % | |
5 | benzamidine | natural abundance | 1 mM | |
6 | inhibitor cocktail | natural abundance | 1 na |
Bruker Avance - 800 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PA1076 | [U-100% 13C; U-100% 15N] | 0.7-1 mM | |
2 | TRIS | [U-2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | sodium azide | natural abundance | 0.01 % | |
5 | benzamidine | natural abundance | 1 mM | |
6 | inhibitor cocktail | natural abundance | 1 na |
Bruker Avance - 500 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PA1076 | [U-100% 13C; U-100% 15N] | 0.7-1 mM | |
2 | TRIS | [U-2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | sodium azide | natural abundance | 0.01 % | |
5 | benzamidine | natural abundance | 1 mM | |
6 | inhibitor cocktail | natural abundance | 1 na |
Bruker Avance - 800 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PA1076 | [U-100% 13C; U-100% 15N] | 0.7-1 mM | |
2 | TRIS | [U-2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | sodium azide | natural abundance | 0.01 % | |
5 | benzamidine | natural abundance | 1 mM | |
6 | inhibitor cocktail | natural abundance | 1 na |
Bruker Avance - 800 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PA1076 | [U-100% 13C; U-100% 15N] | 0.7-1 mM | |
2 | TRIS | [U-2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | sodium azide | natural abundance | 0.01 % | |
5 | benzamidine | natural abundance | 1 mM | |
6 | inhibitor cocktail | natural abundance | 1 na |
Bruker Avance - 800 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PA1076 | [U-100% 13C; U-100% 15N] | 0.7-1 mM | |
2 | TRIS | [U-2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | sodium azide | natural abundance | 0.01 % | |
5 | benzamidine | natural abundance | 1 mM | |
6 | inhibitor cocktail | natural abundance | 1 na |
Bruker Avance - 500 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PA1076 | [U-100% 13C; U-100% 15N] | 0.7-1 mM | |
2 | TRIS | [U-2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | sodium azide | natural abundance | 0.01 % | |
5 | benzamidine | natural abundance | 1 mM | |
6 | inhibitor cocktail | natural abundance | 1 na |
Bruker Avance - 500 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PA1076 | [U-100% 13C; U-100% 15N] | 0.7-1 mM | |
2 | TRIS | [U-2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | sodium azide | natural abundance | 0.01 % | |
5 | benzamidine | natural abundance | 1 mM | |
6 | inhibitor cocktail | natural abundance | 1 na |
Bruker Avance - 500 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PA1076 | [U-100% 13C; U-100% 15N] | 0.7-1 mM | |
2 | TRIS | [U-2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | sodium azide | natural abundance | 0.01 % | |
5 | benzamidine | natural abundance | 1 mM | |
6 | inhibitor cocktail | natural abundance | 1 na |
Bruker Avance - 500 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PA1076 | [U-100% 13C; U-100% 15N] | 0.7-1 mM | |
2 | TRIS | [U-2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | sodium azide | natural abundance | 0.01 % | |
5 | benzamidine | natural abundance | 1 mM | |
6 | inhibitor cocktail | natural abundance | 1 na |
Bruker Avance - 500 MHz cryoprobe
State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PA1076 | [U-100% 13C; U-100% 15N] | 0.7-1 mM | |
2 | TRIS | [U-2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | sodium azide | natural abundance | 0.01 % | |
5 | benzamidine | natural abundance | 1 mM | |
6 | inhibitor cocktail | natural abundance | 1 na |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_15810_2k4v.nef |
Input source #2: Coordindates | 2k4v.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 QGHMFEPGHLHLVSLPGLDQQDINIHIRYEVRQNAESGAYVHFDMDGEIDGKPFSDSFELPRDTAFNFASDATRVAQKHGLHPKFGAITRVHKEYDAMFE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| QGHMFEPGHLHLVSLPGLDQQDINIHIRYEVRQNAESGAYVHFDMDGEIDGKPFSDSFELPRDTAFNFASDATRVAQKHGLHPKFGAITRVHKEYDAMFE -------110-------120----- DIRAKLHAHPGEPVDLERIIRHEGS ||||||||||||||||||||||||| DIRAKLHAHPGEPVDLERIIRHEGS
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 125 | 0 | 0 | 100.0 |
Content subtype: combined_15810_2k4v.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 QGHMFEPGHLHLVSLPGLDQQDINIHIRYEVRQNAESGAYVHFDMDGEIDGKPFSDSFELPRDTAFNFASDATRVAQKHGLHPKFGAITRVHKEYDAMFE ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||| QGHMFEPGHLHLVSLPGLDQQDINIHIRYEVRQNAESGAYVHFDMDGEIDGKPFSDSFELPRDTAFNFASDATRVAQKHGL.PKFGAITRVHKEYDAMFE -------110-------120----- DIRAKLHAHPGEPVDLERIIRHEGS ||||||||||||||||||||||||| DIRAKLHAHPGEPVDLERIIRHEGS
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 754 | 681 | 90.3 |
13C chemical shifts | 568 | 500 | 88.0 |
15N chemical shifts | 134 | 102 | 76.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 253 | 228 | 90.1 |
13C chemical shifts | 250 | 213 | 85.2 |
15N chemical shifts | 118 | 96 | 81.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 501 | 453 | 90.4 |
13C chemical shifts | 318 | 287 | 90.3 |
15N chemical shifts | 16 | 6 | 37.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 60 | 58 | 96.7 |
13C chemical shifts | 60 | 58 | 96.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 74 | 52 | 70.3 |
13C chemical shifts | 74 | 52 | 70.3 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 QGHMFEPGHLHLVSLPGLDQQDINIHIRYEVRQNAESGAYVHFDMDGEIDGKPFSDSFELPRDTAFNFASDATRVAQKHGLHPKFGAITRVHKEYDAMFE | |||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| | |||||||||||||| Q.HMFEPGHLHLVSLPGL.QQDINIHIRYEVRQNAESGAYVHFDMDGEIDGKPFSDSFELPRDTAFNFASDATRVAQKHGL..K..AITRVHKEYDAMFE -------110-------120----- DIRAKLHAHPGEPVDLERIIRHEGS ||||||||||||||||||||| | DIRAKLHAHPGEPVDLERIIR...S
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 QGHMFEPGHLHLVSLPGLDQQDINIHIRYEVRQNAESGAYVHFDMDGEIDGKPFSDSFELPRDTAFNFASDATRVAQKHGLHPKFGAITRVHKEYDAMFE ||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||| ||| ||||||| ..HMFEPGHLHLVSL......DINIHIRYEVRQNAESGAYVHFDMDGEIDGKPFSDSFELPRDTAFNFASDATRVAQKHG..PKFG.ITR...EYDAMFE --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120----- DIRAKLHAHPGEPVDLERIIRHEGS |||||||| ||| ||| ||| DIRAKLHA..GEP.DLE...RHE -------110-------120---
RDC restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 QGHMFEPGHLHLVSLPGLDQQDINIHIRYEVRQNAESGAYVHFDMDGEIDGKPFSDSFELPRDTAFNFASDATRVAQKHGLHPKFGAITRVHKEYDAMFE | ||||| | |||||||||||||| ||||||||||||||| ||||||| ||||||||||||||||||| | ||| .....E.GHLHL.S......QDINIHIRYEVRQN...GAYVHFDMDGEIDGK.FSDSFEL.RDTAFNFASDATRVAQKHG...............D.MFE --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120----- DIRAKLHAHPGEPVDLERIIRHEGS ||||||| .IRAKLHA --------