Solution NMR Structure of Allochromatium vinosum DsrR: Northeast Structural Genomics Consortium Target OP5
MGSSHHHHHH SSGLVPRGSH MMFKLTPAAA EQVLKAAKQG GTEGMCLRLA AGRNPDGSID YRMGFDDLTE DDIRLTSEGV EIVIAPDYVS LLDQTTLDYV ELEPGQFHFI FLNPRDPTYR PPSGG
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 79.9 % (1114 of 1395) | 80.1 % (578 of 722) | 78.8 % (434 of 551) | 83.6 % (102 of 122) |
Backbone | 81.7 % (598 of 732) | 81.9 % (208 of 254) | 81.2 % (294 of 362) | 82.8 % (96 of 116) |
Sidechain | 78.7 % (610 of 775) | 79.1 % (370 of 468) | 77.7 % (234 of 301) | 100.0 % (6 of 6) |
Aromatic | 41.2 % (47 of 114) | 43.9 % (25 of 57) | 38.6 % (22 of 57) | |
Methyl | 93.4 % (114 of 122) | 93.4 % (57 of 61) | 93.4 % (57 of 61) |
1. DsrR
MGSSHHHHHH SSGLVPRGSH MMFKLTPAAA EQVLKAAKQG GTEGMCLRLA AGRNPDGSID YRMGFDDLTE DDIRLTSEGV EIVIAPDYVS LLDQTTLDYV ELEPGQFHFI FLNPRDPTYR PPSGGSolvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DsrR | [U-10% 13C; U-100% 15N] | 1 (±0.1) mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % | |
4 | Tris HCl | natural abundance | 50 mM | |
5 | sodium chloride | natural abundance | 500 mM | |
6 | DTT | natural abundance | 5 mM | |
7 | sodium azide | natural abundance | 0.02 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 293 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | DsrR | [U-100% 13C; U-100% 15N] | 1 (±0.1) mM | |
9 | D2O | natural abundance | 100 % | |
10 | Tris HCl | natural abundance | 50 mM | |
11 | sodium chloride | natural abundance | 500 mM | |
12 | DTT | natural abundance | 5 mM | |
13 | sodium azide | natural abundance | 0.02 % |
Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
14 | DsrR | [U-100% 13C; U-100% 15N] | 1 (±0.1) mM | |
15 | H2O | natural abundance | 93 % | |
16 | D2O | natural abundance | 7 % | |
17 | Tris HCl | natural abundance | 50 mM | |
18 | sodium chloride | natural abundance | 500 mM | |
19 | DTT | natural abundance | 5 mM | |
20 | sodium azide | natural abundance | 0.02 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DsrR | [U-10% 13C; U-100% 15N] | 1 (±0.1) mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % | |
4 | Tris HCl | natural abundance | 50 mM | |
5 | sodium chloride | natural abundance | 500 mM | |
6 | DTT | natural abundance | 5 mM | |
7 | sodium azide | natural abundance | 0.02 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DsrR | [U-10% 13C; U-100% 15N] | 1 (±0.1) mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % | |
4 | Tris HCl | natural abundance | 50 mM | |
5 | sodium chloride | natural abundance | 500 mM | |
6 | DTT | natural abundance | 5 mM | |
7 | sodium azide | natural abundance | 0.02 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DsrR | [U-10% 13C; U-100% 15N] | 1 (±0.1) mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % | |
4 | Tris HCl | natural abundance | 50 mM | |
5 | sodium chloride | natural abundance | 500 mM | |
6 | DTT | natural abundance | 5 mM | |
7 | sodium azide | natural abundance | 0.02 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DsrR | [U-10% 13C; U-100% 15N] | 1 (±0.1) mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % | |
4 | Tris HCl | natural abundance | 50 mM | |
5 | sodium chloride | natural abundance | 500 mM | |
6 | DTT | natural abundance | 5 mM | |
7 | sodium azide | natural abundance | 0.02 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DsrR | [U-10% 13C; U-100% 15N] | 1 (±0.1) mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % | |
4 | Tris HCl | natural abundance | 50 mM | |
5 | sodium chloride | natural abundance | 500 mM | |
6 | DTT | natural abundance | 5 mM | |
7 | sodium azide | natural abundance | 0.02 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DsrR | [U-10% 13C; U-100% 15N] | 1 (±0.1) mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % | |
4 | Tris HCl | natural abundance | 50 mM | |
5 | sodium chloride | natural abundance | 500 mM | |
6 | DTT | natural abundance | 5 mM | |
7 | sodium azide | natural abundance | 0.02 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DsrR | [U-10% 13C; U-100% 15N] | 1 (±0.1) mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % | |
4 | Tris HCl | natural abundance | 50 mM | |
5 | sodium chloride | natural abundance | 500 mM | |
6 | DTT | natural abundance | 5 mM | |
7 | sodium azide | natural abundance | 0.02 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DsrR | [U-10% 13C; U-100% 15N] | 1 (±0.1) mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % | |
4 | Tris HCl | natural abundance | 50 mM | |
5 | sodium chloride | natural abundance | 500 mM | |
6 | DTT | natural abundance | 5 mM | |
7 | sodium azide | natural abundance | 0.02 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DsrR | [U-10% 13C; U-100% 15N] | 1 (±0.1) mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % | |
4 | Tris HCl | natural abundance | 50 mM | |
5 | sodium chloride | natural abundance | 500 mM | |
6 | DTT | natural abundance | 5 mM | |
7 | sodium azide | natural abundance | 0.02 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DsrR | [U-10% 13C; U-100% 15N] | 1 (±0.1) mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % | |
4 | Tris HCl | natural abundance | 50 mM | |
5 | sodium chloride | natural abundance | 500 mM | |
6 | DTT | natural abundance | 5 mM | |
7 | sodium azide | natural abundance | 0.02 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DsrR | [U-10% 13C; U-100% 15N] | 1 (±0.1) mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % | |
4 | Tris HCl | natural abundance | 50 mM | |
5 | sodium chloride | natural abundance | 500 mM | |
6 | DTT | natural abundance | 5 mM | |
7 | sodium azide | natural abundance | 0.02 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | DsrR | [U-100% 13C; U-100% 15N] | 1 (±0.1) mM | |
9 | D2O | natural abundance | 100 % | |
10 | Tris HCl | natural abundance | 50 mM | |
11 | sodium chloride | natural abundance | 500 mM | |
12 | DTT | natural abundance | 5 mM | |
13 | sodium azide | natural abundance | 0.02 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
14 | DsrR | [U-100% 13C; U-100% 15N] | 1 (±0.1) mM | |
15 | H2O | natural abundance | 93 % | |
16 | D2O | natural abundance | 7 % | |
17 | Tris HCl | natural abundance | 50 mM | |
18 | sodium chloride | natural abundance | 500 mM | |
19 | DTT | natural abundance | 5 mM | |
20 | sodium azide | natural abundance | 0.02 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | DsrR | [U-100% 13C; U-100% 15N] | 1 (±0.1) mM | |
9 | D2O | natural abundance | 100 % | |
10 | Tris HCl | natural abundance | 50 mM | |
11 | sodium chloride | natural abundance | 500 mM | |
12 | DTT | natural abundance | 5 mM | |
13 | sodium azide | natural abundance | 0.02 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_15816_2k4z.nef |
Input source #2: Coordindates | 2k4z.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-----------------------------10--------20--------30--------40--------50--------60--------70--------8 MGSSHHHHHHSSGLVPRGSHMMFKLTPAAAEQVLKAAKQGGTEGMCLRLAAGRNPDGSIDYRMGFDDLTEDDIRLTSEGVEIVIAPDYVSLLDQTTLDYV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGSSHHHHHHSSGLVPRGSHMMFKLTPAAAEQVLKAAKQGGTEGMCLRLAAGRNPDGSIDYRMGFDDLTEDDIRLTSEGVEIVIAPDYVSLLDQTTLDYV --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 0--------90-------100---- ELEPGQFHFIFLNPRDPTYRPPSGG ||||||||||||||||||||||||| ELEPGQFHFIFLNPRDPTYRPPSGG -------110-------120-----
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 125 | 0 | 0 | 100.0 |
Content subtype: combined_15816_2k4z.nef
Assigned chemical shifts
-----------------------------10--------20--------30--------40--------50--------60--------70--------8 MGSSHHHHHHSSGLVPRGSHMMFKLTPAAAEQVLKAAKQGGTEGMCLRLAAGRNPDGSIDYRMGFDDLTEDDIRLTSEGVEIVIAPDYVSLLDQTTLDYV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ....................MMFKLTPAAAEQVLKAAKQGGTEGMCLRLAAGRNPDGSIDYRMGFDDLTEDDIRLTSEGVEIVIAPDYVSLLDQTTLDYV 0--------90-------100---- ELEPGQFHFIFLNPRDPTYRPPSGG |||||||||||||||||||| || ELEPGQFHFIFLNPRDPTYR...GG
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
5 | THR | HG1 | 5.75 |
11 | GLN | CD | 178.4 |
18 | GLN | CD | 180.1 |
33 | ASN | CG | 176.6 |
73 | GLN | CD | 180.7 |
85 | GLN | CD | 180.3 |
92 | ASN | CG | 175.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 722 | 563 | 78.0 |
13C chemical shifts | 551 | 425 | 77.1 |
15N chemical shifts | 129 | 101 | 78.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 254 | 203 | 79.9 |
13C chemical shifts | 250 | 195 | 78.0 |
15N chemical shifts | 116 | 94 | 81.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 468 | 360 | 76.9 |
13C chemical shifts | 301 | 230 | 76.4 |
15N chemical shifts | 13 | 7 | 53.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 66 | 61 | 92.4 |
13C chemical shifts | 66 | 61 | 92.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 57 | 22 | 38.6 |
13C chemical shifts | 57 | 22 | 38.6 |
Distance restraints
-----------------------------10--------20--------30--------40--------50--------60--------70--------8 MGSSHHHHHHSSGLVPRGSHMMFKLTPAAAEQVLKAAKQGGTEGMCLRLAAGRNPDGSIDYRMGFDDLTEDDIRLTSEGVEIVIAPDYVSLLDQTTLDYV ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .....................MFKLTPAAAEQVLKAAKQGGTEGMCLRLAAGRNPDGSIDYRMGFDDLTEDDIRLTSEGVEIVIAPDYVSLLDQTTLDYV -----------------------------10--------20--------30--------40--------50--------60--------70--------8 0--------90-------100---- ELEPGQFHFIFLNPRDPTYRPPSGG |||||||||||||||||||| ELEPGQFHFIFLNPRDPTYR 0--------90---------
Dihedral angle restraints