Structure of uncharacterized protein MJ1198 from Methanocaldococcus jannaschii. Northeast Structural Genomics Target MjR117B
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 97.0 % (887 of 914) | 96.5 % (466 of 483) | 97.5 % (346 of 355) | 98.7 % (75 of 76) |
Backbone | 98.6 % (430 of 436) | 98.0 % (146 of 149) | 99.1 % (215 of 217) | 98.6 % (69 of 70) |
Sidechain | 96.2 % (526 of 547) | 96.1 % (321 of 334) | 96.1 % (199 of 207) | 100.0 % (6 of 6) |
Aromatic | 92.6 % (50 of 54) | 100.0 % (27 of 27) | 85.2 % (23 of 27) | |
Methyl | 98.9 % (93 of 94) | 97.9 % (46 of 47) | 100.0 % (47 of 47) |
1. MjR117B
MDVEPGKFYK GVVTRIEKYG AFINLNEQVR GLLRPRDMIS LRLENLNVGD EIIVQAIDVR PEKREIDFKY IPLESolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details PST ID: MjR117B.006
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MjR117B | [U-100% 13C; U-100% 15N] | 1.682 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | sodium azide | natural abundance | 0.02 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | DSS | natural abundance | 50 uM | |
7 | calcium chloride | natural abundance | 5 mM | |
8 | protease inhibitor | natural abundance | 1x mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | [U-100% 2H] | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details PST ID: MjR117B.008
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | MjR117B | [5% 13C; U-100% 15N] | 1.226 mM | |
12 | ammonium acetate | natural abundance | 20 mM | |
13 | sodium chloride | natural abundance | 100 mM | |
14 | sodium azide | natural abundance | 0.02 mM | |
15 | DTT | natural abundance | 10 mM | |
16 | DSS | natural abundance | 50 uM | |
17 | calcium chloride | natural abundance | 5 mM | |
18 | protease inhibitor | natural abundance | 1x mM | |
19 | H2O | natural abundance | 90 % | |
20 | D2O | [U-100% 2H] | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details PST ID: MjR117B.006
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MjR117B | [U-100% 13C; U-100% 15N] | 1.682 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | sodium azide | natural abundance | 0.02 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | DSS | natural abundance | 50 uM | |
7 | calcium chloride | natural abundance | 5 mM | |
8 | protease inhibitor | natural abundance | 1x mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details PST ID: MjR117B.006
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MjR117B | [U-100% 13C; U-100% 15N] | 1.682 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | sodium azide | natural abundance | 0.02 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | DSS | natural abundance | 50 uM | |
7 | calcium chloride | natural abundance | 5 mM | |
8 | protease inhibitor | natural abundance | 1x mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details PST ID: MjR117B.006
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MjR117B | [U-100% 13C; U-100% 15N] | 1.682 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | sodium azide | natural abundance | 0.02 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | DSS | natural abundance | 50 uM | |
7 | calcium chloride | natural abundance | 5 mM | |
8 | protease inhibitor | natural abundance | 1x mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details PST ID: MjR117B.006
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MjR117B | [U-100% 13C; U-100% 15N] | 1.682 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | sodium azide | natural abundance | 0.02 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | DSS | natural abundance | 50 uM | |
7 | calcium chloride | natural abundance | 5 mM | |
8 | protease inhibitor | natural abundance | 1x mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details PST ID: MjR117B.006
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MjR117B | [U-100% 13C; U-100% 15N] | 1.682 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | sodium azide | natural abundance | 0.02 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | DSS | natural abundance | 50 uM | |
7 | calcium chloride | natural abundance | 5 mM | |
8 | protease inhibitor | natural abundance | 1x mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details PST ID: MjR117B.006
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MjR117B | [U-100% 13C; U-100% 15N] | 1.682 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | sodium azide | natural abundance | 0.02 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | DSS | natural abundance | 50 uM | |
7 | calcium chloride | natural abundance | 5 mM | |
8 | protease inhibitor | natural abundance | 1x mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details PST ID: MjR117B.006
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MjR117B | [U-100% 13C; U-100% 15N] | 1.682 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | sodium azide | natural abundance | 0.02 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | DSS | natural abundance | 50 uM | |
7 | calcium chloride | natural abundance | 5 mM | |
8 | protease inhibitor | natural abundance | 1x mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details PST ID: MjR117B.006
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MjR117B | [U-100% 13C; U-100% 15N] | 1.682 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | sodium azide | natural abundance | 0.02 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | DSS | natural abundance | 50 uM | |
7 | calcium chloride | natural abundance | 5 mM | |
8 | protease inhibitor | natural abundance | 1x mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details PST ID: MjR117B.006
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MjR117B | [U-100% 13C; U-100% 15N] | 1.682 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | sodium azide | natural abundance | 0.02 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | DSS | natural abundance | 50 uM | |
7 | calcium chloride | natural abundance | 5 mM | |
8 | protease inhibitor | natural abundance | 1x mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details PST ID: MjR117B.006
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MjR117B | [U-100% 13C; U-100% 15N] | 1.682 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | sodium azide | natural abundance | 0.02 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | DSS | natural abundance | 50 uM | |
7 | calcium chloride | natural abundance | 5 mM | |
8 | protease inhibitor | natural abundance | 1x mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details PST ID: MjR117B.006
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MjR117B | [U-100% 13C; U-100% 15N] | 1.682 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | sodium azide | natural abundance | 0.02 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | DSS | natural abundance | 50 uM | |
7 | calcium chloride | natural abundance | 5 mM | |
8 | protease inhibitor | natural abundance | 1x mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details PST ID: MjR117B.006
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MjR117B | [U-100% 13C; U-100% 15N] | 1.682 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | sodium azide | natural abundance | 0.02 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | DSS | natural abundance | 50 uM | |
7 | calcium chloride | natural abundance | 5 mM | |
8 | protease inhibitor | natural abundance | 1x mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details PST ID: MjR117B.006
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MjR117B | [U-100% 13C; U-100% 15N] | 1.682 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | sodium azide | natural abundance | 0.02 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | DSS | natural abundance | 50 uM | |
7 | calcium chloride | natural abundance | 5 mM | |
8 | protease inhibitor | natural abundance | 1x mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details PST ID: MjR117B.006
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MjR117B | [U-100% 13C; U-100% 15N] | 1.682 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | sodium azide | natural abundance | 0.02 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | DSS | natural abundance | 50 uM | |
7 | calcium chloride | natural abundance | 5 mM | |
8 | protease inhibitor | natural abundance | 1x mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details PST ID: MjR117B.008
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | MjR117B | [5% 13C; U-100% 15N] | 1.226 mM | |
12 | ammonium acetate | natural abundance | 20 mM | |
13 | sodium chloride | natural abundance | 100 mM | |
14 | sodium azide | natural abundance | 0.02 mM | |
15 | DTT | natural abundance | 10 mM | |
16 | DSS | natural abundance | 50 uM | |
17 | calcium chloride | natural abundance | 5 mM | |
18 | protease inhibitor | natural abundance | 1x mM | |
19 | H2O | natural abundance | 90 % | |
20 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details PST ID: MjR117B.008
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | MjR117B | [5% 13C; U-100% 15N] | 1.226 mM | |
12 | ammonium acetate | natural abundance | 20 mM | |
13 | sodium chloride | natural abundance | 100 mM | |
14 | sodium azide | natural abundance | 0.02 mM | |
15 | DTT | natural abundance | 10 mM | |
16 | DSS | natural abundance | 50 uM | |
17 | calcium chloride | natural abundance | 5 mM | |
18 | protease inhibitor | natural abundance | 1x mM | |
19 | H2O | natural abundance | 90 % | |
20 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details PST ID: MjR117B.008
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | MjR117B | [5% 13C; U-100% 15N] | 1.226 mM | |
12 | ammonium acetate | natural abundance | 20 mM | |
13 | sodium chloride | natural abundance | 100 mM | |
14 | sodium azide | natural abundance | 0.02 mM | |
15 | DTT | natural abundance | 10 mM | |
16 | DSS | natural abundance | 50 uM | |
17 | calcium chloride | natural abundance | 5 mM | |
18 | protease inhibitor | natural abundance | 1x mM | |
19 | H2O | natural abundance | 90 % | |
20 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details PST ID: MjR117B.008
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | MjR117B | [5% 13C; U-100% 15N] | 1.226 mM | |
12 | ammonium acetate | natural abundance | 20 mM | |
13 | sodium chloride | natural abundance | 100 mM | |
14 | sodium azide | natural abundance | 0.02 mM | |
15 | DTT | natural abundance | 10 mM | |
16 | DSS | natural abundance | 50 uM | |
17 | calcium chloride | natural abundance | 5 mM | |
18 | protease inhibitor | natural abundance | 1x mM | |
19 | H2O | natural abundance | 90 % | |
20 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details PST ID: MjR117B.008
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | MjR117B | [5% 13C; U-100% 15N] | 1.226 mM | |
12 | ammonium acetate | natural abundance | 20 mM | |
13 | sodium chloride | natural abundance | 100 mM | |
14 | sodium azide | natural abundance | 0.02 mM | |
15 | DTT | natural abundance | 10 mM | |
16 | DSS | natural abundance | 50 uM | |
17 | calcium chloride | natural abundance | 5 mM | |
18 | protease inhibitor | natural abundance | 1x mM | |
19 | H2O | natural abundance | 90 % | |
20 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details PST ID: MjR117B.006
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MjR117B | [U-100% 13C; U-100% 15N] | 1.682 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | sodium azide | natural abundance | 0.02 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | DSS | natural abundance | 50 uM | |
7 | calcium chloride | natural abundance | 5 mM | |
8 | protease inhibitor | natural abundance | 1x mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | [U-100% 2H] | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_15821_2k52.nef |
Input source #2: Coordindates | 2k52.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80 MDVEPGKFYKGVVTRIEKYGAFINLNEQVRGLLRPRDMISLRLENLNVGDEIIVQAIDVRPEKREIDFKYIPLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MDVEPGKFYKGVVTRIEKYGAFINLNEQVRGLLRPRDMISLRLENLNVGDEIIVQAIDVRPEKREIDFKYIPLEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 80 | 0 | 0 | 100.0 |
Content subtype: combined_15821_2k52.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80 MDVEPGKFYKGVVTRIEKYGAFINLNEQVRGLLRPRDMISLRLENLNVGDEIIVQAIDVRPEKREIDFKYIPLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MDVEPGKFYKGVVTRIEKYGAFINLNEQVRGLLRPRDMISLRLENLNVGDEIIVQAIDVRPEKREIDFKYIPLE --------10--------20--------30--------40--------50--------60--------70----
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 519 | 468 | 90.2 |
13C chemical shifts | 385 | 346 | 89.9 |
15N chemical shifts | 89 | 75 | 84.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 161 | 148 | 91.9 |
13C chemical shifts | 160 | 147 | 91.9 |
15N chemical shifts | 76 | 69 | 90.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 358 | 320 | 89.4 |
13C chemical shifts | 225 | 199 | 88.4 |
15N chemical shifts | 13 | 6 | 46.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 49 | 49 | 100.0 |
13C chemical shifts | 49 | 49 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 39 | 27 | 69.2 |
13C chemical shifts | 39 | 23 | 59.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80 MDVEPGKFYKGVVTRIEKYGAFINLNEQVRGLLRPRDMISLRLENLNVGDEIIVQAIDVRPEKREIDFKYIPLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MDVEPGKFYKGVVTRIEKYGAFINLNEQVRGLLRPRDMISLRLENLNVGDEIIVQAIDVRPEKREIDFKYIPLE --------10--------20--------30--------40--------50--------60--------70----
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80 MDVEPGKFYKGVVTRIEKYGAFINLNEQVRGLLRPRDMISLRLENLNVGDEIIVQAIDVRPEKREIDFKYIPLEHHHHHH |||| |||||||||||| |||||| |||||||||||||||||||||||||||||||||||||||||||||| MDVE..KFYKGVVTRIEK.GAFINL.EQVRGLLRPRDMISLRLENLNVGDEIIVQAIDVRPEKREIDFKYIP --------10--------20--------30--------40--------50--------60--------70--