Solution NMR structure of protein encoded by MTH693 from Methanobacterium thermoautotrophicum: Northeast Structural Genomics Consortium target tt824a
MGSSHHHHHH SSGRENLYFQ GHMAARITGE PSKKAVSDRL IGRKGVVMEA ISPQNSGLVK VDGETWRATS GTVLDVGEEV SVKAIEGVKL VVEKLEEQKG S
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 86.8 % (972 of 1120) | 85.9 % (499 of 581) | 87.1 % (378 of 434) | 90.5 % (95 of 105) |
Backbone | 87.5 % (527 of 602) | 86.3 % (183 of 212) | 87.6 % (255 of 291) | 89.9 % (89 of 99) |
Sidechain | 86.3 % (524 of 607) | 85.6 % (316 of 369) | 87.1 % (202 of 232) | 100.0 % (6 of 6) |
Aromatic | 51.7 % (30 of 58) | 58.6 % (17 of 29) | 42.9 % (12 of 28) | 100.0 % (1 of 1) |
Methyl | 100.0 % (108 of 108) | 100.0 % (54 of 54) | 100.0 % (54 of 54) |
1. tt824a
MGSSHHHHHH SSGRENLYFQ GHMAARITGE PSKKAVSDRL IGRKGVVMEA ISPQNSGLVK VDGETWRATS GTVLDVGEEV SVKAIEGVKL VVEKLEEQKG SSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | [U-100% 2H] | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | [U-100% 2H] | 10 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | [U-100% 2H] | 10 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | [U-100% 2H] | 10 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | [U-100% 2H] | 10 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | [U-100% 2H] | 10 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | [U-100% 2H] | 10 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | [U-100% 2H] | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_15836_2k5h.nef |
Input source #2: Coordindates | 2k5h.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGSSHHHHHHSSGRENLYFQGHMAARITGEPSKKAVSDRLIGRKGVVMEAISPQNSGLVKVDGETWRATSGTVLDVGEEVSVKAIEGVKLVVEKLEEQKG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGSSHHHHHHSSGRENLYFQGHMAARITGEPSKKAVSDRLIGRKGVVMEAISPQNSGLVKVDGETWRATSGTVLDVGEEVSVKAIEGVKLVVEKLEEQKG - S | S
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 101 | 0 | 0 | 100.0 |
Content subtype: combined_15836_2k5h.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGSSHHHHHHSSGRENLYFQGHMAARITGEPSKKAVSDRLIGRKGVVMEAISPQNSGLVKVDGETWRATSGTVLDVGEEVSVKAIEGVKLVVEKLEEQKG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..........SSGRENLYFQGHMAARITGEPSKKAVSDRLIGRKGVVMEAISPQNSGLVKVDGETWRATSGTVLDVGEEVSVKAIEGVKLVVEKLEEQKG - S | S
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 434 | 374 | 86.2 |
1H chemical shifts | 581 | 507 | 87.3 |
15N chemical shifts | 110 | 94 | 85.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 202 | 174 | 86.1 |
1H chemical shifts | 212 | 185 | 87.3 |
15N chemical shifts | 99 | 88 | 88.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 232 | 200 | 86.2 |
1H chemical shifts | 369 | 322 | 87.3 |
15N chemical shifts | 11 | 6 | 54.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 57 | 55 | 96.5 |
1H chemical shifts | 57 | 55 | 96.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 28 | 12 | 42.9 |
1H chemical shifts | 29 | 17 | 58.6 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGSSHHHHHHSSGRENLYFQGHMAARITGEPSKKAVSDRLIGRKGVVMEAISPQNSGLVKVDGETWRATSGTVLDVGEEVSVKAIEGVKLVVEKLEEQKG |||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..............ENLYFQ..MAARITGEPSKKAVSDRLIGRKGVVMEAISPQNSGLVKVDGETWRATSGTVLDVGEEVSVKAIEGVKLVVEKLEEQK --------10--------20--------30--------40--------50--------60--------70--------80--------90--------- - S
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGSSHHHHHHSSGRENLYFQGHMAARITGEPSKKAVSDRLIGRKGVVMEAISPQNSGLVKVDGETWRATSGTVLDVGEEVSVKAIEGVKLVVEKLEEQKG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .......................AARITGEPSKKAVSDRLIGRKGVVMEAISPQNSGLVKVDGETWRATSGTVLDVGEEVSVKAIEGVKLVVEKLEEQK --------10--------20--------30--------40--------50--------60--------70--------80--------90--------- - S