LC3 p62 complex structure
SMPSEKTFKQ RRSFEQRVED VRLIREQHPT KIPVIIERYK GEKQLPVLDK TKFLVPDHVN MSELIKIIRR RLQLNANQAF FLLVNGHSMV SVSTPISEVY ESERDEDGFL YMVYASQETF G
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 95.4 % (1591 of 1668) | 96.6 % (846 of 876) | 92.9 % (602 of 648) | 99.3 % (143 of 144) |
Backbone | 97.7 % (797 of 816) | 98.2 % (271 of 276) | 96.8 % (395 of 408) | 99.2 % (131 of 132) |
Sidechain | 93.8 % (923 of 984) | 95.8 % (575 of 600) | 90.3 % (336 of 372) | 100.0 % (12 of 12) |
Aromatic | 75.4 % (98 of 130) | 93.8 % (61 of 65) | 56.3 % (36 of 64) | 100.0 % (1 of 1) |
Methyl | 98.6 % (140 of 142) | 97.2 % (69 of 71) | 100.0 % (71 of 71) |
1. LC3
SMPSEKTFKQ RRSFEQRVED VRLIREQHPT KIPVIIERYK GEKQLPVLDK TKFLVPDHVN MSELIKIIRR RLQLNANQAF FLLVNGHSMV SVSTPISEVY ESERDEDGFL YMVYASQETF G2. p62 peptide
MSGGDDDWTH LSSKEVDSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LC3 | [U-99% 13C; U-99% 15N] | 0.8 mM | |
2 | p62 peptide | natural abundance | 1.2 mM | |
3 | sodium phosphate | natural abundance | 25 mM | |
4 | sodium chloride | natural abundance | 100 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | [U-100% 2H] | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | p62 peptide | [U-99% 13C; U-99% 15N] | 0.8 mM | |
8 | LC3 | natural abundance | 1.2 mM | |
9 | sodium phosphate | natural abundance | 25 mM | |
10 | sodium chloride | natural abundance | 100 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | [U-100% 2H] | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LC3 | [U-99% 13C; U-99% 15N] | 0.8 mM | |
2 | p62 peptide | natural abundance | 1.2 mM | |
3 | sodium phosphate | natural abundance | 25 mM | |
4 | sodium chloride | natural abundance | 100 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | [U-100% 2H] | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LC3 | [U-99% 13C; U-99% 15N] | 0.8 mM | |
2 | p62 peptide | natural abundance | 1.2 mM | |
3 | sodium phosphate | natural abundance | 25 mM | |
4 | sodium chloride | natural abundance | 100 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | [U-100% 2H] | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LC3 | [U-99% 13C; U-99% 15N] | 0.8 mM | |
2 | p62 peptide | natural abundance | 1.2 mM | |
3 | sodium phosphate | natural abundance | 25 mM | |
4 | sodium chloride | natural abundance | 100 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | [U-100% 2H] | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LC3 | [U-99% 13C; U-99% 15N] | 0.8 mM | |
2 | p62 peptide | natural abundance | 1.2 mM | |
3 | sodium phosphate | natural abundance | 25 mM | |
4 | sodium chloride | natural abundance | 100 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | [U-100% 2H] | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LC3 | [U-99% 13C; U-99% 15N] | 0.8 mM | |
2 | p62 peptide | natural abundance | 1.2 mM | |
3 | sodium phosphate | natural abundance | 25 mM | |
4 | sodium chloride | natural abundance | 100 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | [U-100% 2H] | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LC3 | [U-99% 13C; U-99% 15N] | 0.8 mM | |
2 | p62 peptide | natural abundance | 1.2 mM | |
3 | sodium phosphate | natural abundance | 25 mM | |
4 | sodium chloride | natural abundance | 100 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | [U-100% 2H] | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LC3 | [U-99% 13C; U-99% 15N] | 0.8 mM | |
2 | p62 peptide | natural abundance | 1.2 mM | |
3 | sodium phosphate | natural abundance | 25 mM | |
4 | sodium chloride | natural abundance | 100 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | [U-100% 2H] | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LC3 | [U-99% 13C; U-99% 15N] | 0.8 mM | |
2 | p62 peptide | natural abundance | 1.2 mM | |
3 | sodium phosphate | natural abundance | 25 mM | |
4 | sodium chloride | natural abundance | 100 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | [U-100% 2H] | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LC3 | [U-99% 13C; U-99% 15N] | 0.8 mM | |
2 | p62 peptide | natural abundance | 1.2 mM | |
3 | sodium phosphate | natural abundance | 25 mM | |
4 | sodium chloride | natural abundance | 100 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | [U-100% 2H] | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LC3 | [U-99% 13C; U-99% 15N] | 0.8 mM | |
2 | p62 peptide | natural abundance | 1.2 mM | |
3 | sodium phosphate | natural abundance | 25 mM | |
4 | sodium chloride | natural abundance | 100 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | [U-100% 2H] | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LC3 | [U-99% 13C; U-99% 15N] | 0.8 mM | |
2 | p62 peptide | natural abundance | 1.2 mM | |
3 | sodium phosphate | natural abundance | 25 mM | |
4 | sodium chloride | natural abundance | 100 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | [U-100% 2H] | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LC3 | [U-99% 13C; U-99% 15N] | 0.8 mM | |
2 | p62 peptide | natural abundance | 1.2 mM | |
3 | sodium phosphate | natural abundance | 25 mM | |
4 | sodium chloride | natural abundance | 100 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | [U-100% 2H] | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LC3 | [U-99% 13C; U-99% 15N] | 0.8 mM | |
2 | p62 peptide | natural abundance | 1.2 mM | |
3 | sodium phosphate | natural abundance | 25 mM | |
4 | sodium chloride | natural abundance | 100 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | [U-100% 2H] | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | p62 peptide | [U-99% 13C; U-99% 15N] | 0.8 mM | |
8 | LC3 | natural abundance | 1.2 mM | |
9 | sodium phosphate | natural abundance | 25 mM | |
10 | sodium chloride | natural abundance | 100 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | [U-100% 2H] | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | p62 peptide | [U-99% 13C; U-99% 15N] | 0.8 mM | |
8 | LC3 | natural abundance | 1.2 mM | |
9 | sodium phosphate | natural abundance | 25 mM | |
10 | sodium chloride | natural abundance | 100 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | [U-100% 2H] | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | p62 peptide | [U-99% 13C; U-99% 15N] | 0.8 mM | |
8 | LC3 | natural abundance | 1.2 mM | |
9 | sodium phosphate | natural abundance | 25 mM | |
10 | sodium chloride | natural abundance | 100 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | [U-100% 2H] | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | p62 peptide | [U-99% 13C; U-99% 15N] | 0.8 mM | |
8 | LC3 | natural abundance | 1.2 mM | |
9 | sodium phosphate | natural abundance | 25 mM | |
10 | sodium chloride | natural abundance | 100 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | [U-100% 2H] | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | p62 peptide | [U-99% 13C; U-99% 15N] | 0.8 mM | |
8 | LC3 | natural abundance | 1.2 mM | |
9 | sodium phosphate | natural abundance | 25 mM | |
10 | sodium chloride | natural abundance | 100 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | [U-100% 2H] | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | p62 peptide | [U-99% 13C; U-99% 15N] | 0.8 mM | |
8 | LC3 | natural abundance | 1.2 mM | |
9 | sodium phosphate | natural abundance | 25 mM | |
10 | sodium chloride | natural abundance | 100 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | [U-100% 2H] | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | p62 peptide | [U-99% 13C; U-99% 15N] | 0.8 mM | |
8 | LC3 | natural abundance | 1.2 mM | |
9 | sodium phosphate | natural abundance | 25 mM | |
10 | sodium chloride | natural abundance | 100 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | [U-100% 2H] | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | p62 peptide | [U-99% 13C; U-99% 15N] | 0.8 mM | |
8 | LC3 | natural abundance | 1.2 mM | |
9 | sodium phosphate | natural abundance | 25 mM | |
10 | sodium chloride | natural abundance | 100 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | [U-100% 2H] | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | p62 peptide | [U-99% 13C; U-99% 15N] | 0.8 mM | |
8 | LC3 | natural abundance | 1.2 mM | |
9 | sodium phosphate | natural abundance | 25 mM | |
10 | sodium chloride | natural abundance | 100 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | [U-100% 2H] | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_15877_2k6q.nef |
Input source #2: Coordindates | 2k6q.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10 SMPSEKTFKQRRSFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVY |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SMPSEKTFKQRRSFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVY --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 0-------110-------120 ESERDEDGFLYMVYASQETFG ||||||||||||||||||||| ESERDEDGFLYMVYASQETFG -------110-------120-
-------340------- MSGGDDDWTHLSSKEVD ||||||||||||||||| MSGGDDDWTHLSSKEVD --------10-------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 121 | 0 | 0 | 100.0 |
B | B | 17 | 0 | 0 | 100.0 |
Content subtype: combined_15877_2k6q.nef
Assigned chemical shifts
0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10 SMPSEKTFKQRRSFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVY |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SMPSEKTFKQRRSFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVY 0-------110-------120 ESERDEDGFLYMVYASQETFG ||||||||||||||||||||| ESERDEDGFLYMVYASQETFG
-------340------- MSGGDDDWTHLSSKEVD ||||||||||||||||| MSGGDDDWTHLSSKEVD
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
9 | GLN | CD | 180.418 |
15 | GLN | CD | 180.506 |
21 | ARG | CZ | 175.501 |
24 | ARG | CZ | 175.778 |
26 | GLN | CD | 179.627 |
37 | ARG | CZ | 175.847 |
43 | GLN | CD | 180.024 |
59 | ASN | CG | 175.725 |
69 | ARG | CZ | 175.209 |
72 | GLN | CD | 181.421 |
74 | ASN | CG | 176.348 |
76 | ASN | CG | 177.281 |
77 | GLN | CD | 179.926 |
84 | ASN | CG | 178.387 |
116 | GLN | CD | 180.566 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 787 | 771 | 98.0 |
13C chemical shifts | 580 | 541 | 93.3 |
15N chemical shifts | 136 | 129 | 94.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 240 | 238 | 99.2 |
13C chemical shifts | 242 | 234 | 96.7 |
15N chemical shifts | 115 | 114 | 99.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 547 | 533 | 97.4 |
13C chemical shifts | 338 | 307 | 90.8 |
15N chemical shifts | 21 | 15 | 71.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 70 | 70 | 100.0 |
13C chemical shifts | 70 | 70 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 57 | 51 | 89.5 |
13C chemical shifts | 57 | 29 | 50.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 89 | 87 | 97.8 |
13C chemical shifts | 68 | 65 | 95.6 |
15N chemical shifts | 18 | 17 | 94.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 36 | 35 | 97.2 |
13C chemical shifts | 34 | 32 | 94.1 |
15N chemical shifts | 17 | 16 | 94.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 53 | 52 | 98.1 |
13C chemical shifts | 34 | 33 | 97.1 |
15N chemical shifts | 1 | 1 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 6 | 5 | 83.3 |
13C chemical shifts | 6 | 5 | 83.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 8 | 8 | 100.0 |
13C chemical shifts | 7 | 7 | 100.0 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10 SMPSEKTFKQRRSFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVY || |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .MP.EKTFKQRRSFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVY 0-------110-------120 ESERDEDGFLYMVYASQETFG ||||||||||||||||||||| ESERDEDGFLYMVYASQETFG
-------340------- MSGGDDDWTHLSSKEVD | ||||||||||||||| M.GGDDDWTHLSSKEVD
Dihedral angle restraints
0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10 SMPSEKTFKQRRSFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVY ||||||||||||||||||||||| |||||||||||||||||| |||||| |||||||||||||| |||||||||||||| |||||||| .....KTFKQRRSFEQRVEDVRLIREQH.TKIPVIIERYKGEKQLPV.DKTKFL.....NMSELIKIIRRRLQ.NANQAFFLLVNGHS....STPISEVY 0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10 0-------110-------120 ESERDEDGFLYMVYASQETFG ||||||| |||||||||| ESERDED.FLYMVYASQE 0-------110-------