Mechanism of metal delivery to the CuA center in terminal oxidases from bacteria: a redox m nage- -trois
GAMHTFYGTR LLNPKPVDFA LEGPQGPVRL SQFQDKVVLL FFGFTRCPDV CPTTLLALKR AYEKLPPKAQ ERVQVIFVSV DPERDPPEVA DRYAKAFHPS FLGLSGSPEA VREAAQTFGV FYQKSQYRGP GEYLVDHTAT TFVVKEGRLV LLYSPDKAEA TDRVVADLQA LL
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 91.7 % (1852 of 2020) | 95.2 % (998 of 1048) | 85.6 % (689 of 805) | 98.8 % (165 of 167) |
Backbone | 97.4 % (976 of 1002) | 99.1 % (337 of 340) | 95.8 % (484 of 505) | 98.7 % (155 of 157) |
Sidechain | 86.7 % (1022 of 1179) | 92.2 % (653 of 708) | 78.1 % (360 of 461) | 90.0 % (9 of 10) |
Aromatic | 40.4 % (76 of 188) | 79.8 % (75 of 94) | 1.1 % (1 of 94) | |
Methyl | 99.0 % (202 of 204) | 99.0 % (101 of 102) | 99.0 % (101 of 102) |
1. CuA center
GAMHTFYGTR LLNPKPVDFA LEGPQGPVRL SQFQDKVVLL FFGFTRCPDV CPTTLLALKR AYEKLPPKAQ ERVQVIFVSV DPERDPPEVA DRYAKAFHPS FLGLSGSPEA VREAAQTFGV FYQKSQYRGP GEYLVDHTAT TFVVKEGRLV LLYSPDKAEA TDRVVADLQA LLSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 15N] | 0.8 (±0.1) mM | |
2 | D2O | [U-99.9% 2H] | 10 % | |
3 | H2O | natural abundance | 90 % | |
4 | Pi | natural abundance | 50 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | entity | [U-100% 13C; U-100% 15N] | 0.8 (±0.1) mM | |
6 | D2O | [U-99.9% 2H] | 10 % | |
7 | H2O | natural abundance | 90 % | |
8 | Pi | natural abundance | 50 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | dioxane | methyl carbon | 69.46 ppm | external | direct | 1.0 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | dioxane | methyl carbon | 69.46 ppm | external | direct | 1.0 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | dioxane | methyl carbon | 69.46 ppm | external | direct | 1.0 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | dioxane | methyl carbon | 69.46 ppm | external | direct | 1.0 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 15N] | 0.8 (±0.1) mM | |
2 | D2O | [U-99.9% 2H] | 10 % | |
3 | H2O | natural abundance | 90 % | |
4 | Pi | natural abundance | 50 mM |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | entity | [U-100% 13C; U-100% 15N] | 0.8 (±0.1) mM | |
6 | D2O | [U-99.9% 2H] | 10 % | |
7 | H2O | natural abundance | 90 % | |
8 | Pi | natural abundance | 50 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | entity | [U-100% 13C; U-100% 15N] | 0.8 (±0.1) mM | |
6 | D2O | [U-99.9% 2H] | 10 % | |
7 | H2O | natural abundance | 90 % | |
8 | Pi | natural abundance | 50 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | entity | [U-100% 13C; U-100% 15N] | 0.8 (±0.1) mM | |
6 | D2O | [U-99.9% 2H] | 10 % | |
7 | H2O | natural abundance | 90 % | |
8 | Pi | natural abundance | 50 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | entity | [U-100% 13C; U-100% 15N] | 0.8 (±0.1) mM | |
6 | D2O | [U-99.9% 2H] | 10 % | |
7 | H2O | natural abundance | 90 % | |
8 | Pi | natural abundance | 50 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | entity | [U-100% 13C; U-100% 15N] | 0.8 (±0.1) mM | |
6 | D2O | [U-99.9% 2H] | 10 % | |
7 | H2O | natural abundance | 90 % | |
8 | Pi | natural abundance | 50 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | entity | [U-100% 13C; U-100% 15N] | 0.8 (±0.1) mM | |
6 | D2O | [U-99.9% 2H] | 10 % | |
7 | H2O | natural abundance | 90 % | |
8 | Pi | natural abundance | 50 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | entity | [U-100% 13C; U-100% 15N] | 0.8 (±0.1) mM | |
6 | D2O | [U-99.9% 2H] | 10 % | |
7 | H2O | natural abundance | 90 % | |
8 | Pi | natural abundance | 50 mM |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 15N] | 0.8 (±0.1) mM | |
2 | D2O | [U-99.9% 2H] | 10 % | |
3 | H2O | natural abundance | 90 % | |
4 | Pi | natural abundance | 50 mM |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | entity | [U-100% 13C; U-100% 15N] | 0.8 (±0.1) mM | |
6 | D2O | [U-99.9% 2H] | 10 % | |
7 | H2O | natural abundance | 90 % | |
8 | Pi | natural abundance | 50 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 15N] | 0.8 (±0.1) mM | |
2 | D2O | [U-99.9% 2H] | 10 % | |
3 | H2O | natural abundance | 90 % | |
4 | Pi | natural abundance | 50 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 15N] | 0.8 (±0.1) mM | |
2 | D2O | [U-99.9% 2H] | 10 % | |
3 | H2O | natural abundance | 90 % | |
4 | Pi | natural abundance | 50 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 15N] | 0.8 (±0.1) mM | |
2 | D2O | [U-99.9% 2H] | 10 % | |
3 | H2O | natural abundance | 90 % | |
4 | Pi | natural abundance | 50 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_15893_2k6v.nef |
Input source #2: Coordindates | 2k6v.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GAMHTFYGTRLLNPKPVDFALEGPQGPVRLSQFQDKVVLLFFGFTRCPDVCPTTLLALKRAYEKLPPKAQERVQVIFVSVDPERDPPEVADRYAKAFHPS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GAMHTFYGTRLLNPKPVDFALEGPQGPVRLSQFQDKVVLLFFGFTRCPDVCPTTLLALKRAYEKLPPKAQERVQVIFVSVDPERDPPEVADRYAKAFHPS -------110-------120-------130-------140-------150-------160-------170-- FLGLSGSPEAVREAAQTFGVFYQKSQYRGPGEYLVDHTATTFVVKEGRLVLLYSPDKAEATDRVVADLQALL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| FLGLSGSPEAVREAAQTFGVFYQKSQYRGPGEYLVDHTATTFVVKEGRLVLLYSPDKAEATDRVVADLQALL
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 172 | 0 | 0 | 100.0 |
Content subtype: combined_15893_2k6v.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GAMHTFYGTRLLNPKPVDFALEGPQGPVRLSQFQDKVVLLFFGFTRCPDVCPTTLLALKRAYEKLPPKAQERVQVIFVSVDPERDPPEVADRYAKAFHPS ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...HTFYGTRLLNPKPVDFALEGPQGPVRLSQFQDKVVLLFFGFTRCPDVCPTTLLALKRAYEKLPPKAQERVQVIFVSVDPERDPPEVADRYAKAFHPS -------110-------120-------130-------140-------150-------160-------170-- FLGLSGSPEAVREAAQTFGVFYQKSQYRGPGEYLVDHTATTFVVKEGRLVLLYSPDKAEATDRVVADLQALL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| FLGLSGSPEAVREAAQTFGVFYQKSQYRGPGEYLVDHTATTFVVKEGRLVLLYSPDKAEATDRVVADLQALL
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
105 | SER | HG | 5.326 |
141 | THR | HG1 | 5.17 |
153 | TYR | HH | 10.961 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 1048 | 988 | 94.3 |
13C chemical shifts | 805 | 685 | 85.1 |
15N chemical shifts | 178 | 163 | 91.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 340 | 333 | 97.9 |
13C chemical shifts | 344 | 323 | 93.9 |
15N chemical shifts | 157 | 154 | 98.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 708 | 655 | 92.5 |
13C chemical shifts | 461 | 362 | 78.5 |
15N chemical shifts | 21 | 9 | 42.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 103 | 101 | 98.1 |
13C chemical shifts | 103 | 101 | 98.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 94 | 72 | 76.6 |
13C chemical shifts | 94 | 0 | 0.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GAMHTFYGTRLLNPKPVDFALEGPQGPVRLSQFQDKVVLLFFGFTRCPDVCPTTLLALKRAYEKLPPKAQERVQVIFVSVDPERDPPEVADRYAKAFHPS ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...HTFYGTRLLNPKPVDFALEGPQGPVRLSQFQDKVVLLFFGFTRCPDVCPTTLLALKRAYEKLPPKAQERVQVIFVSVDPERDPPEVADRYAKAFHPS -------110-------120-------130-------140-------150-------160-------170-- FLGLSGSPEAVREAAQTFGVFYQKSQYRGPGEYLVDHTATTFVVKEGRLVLLYSPDKAEATDRVVADLQALL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| FLGLSGSPEAVREAAQTFGVFYQKSQYRGPGEYLVDHTATTFVVKEGRLVLLYSPDKAEATDRVVADLQALL
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GAMHTFYGTRLLNPKPVDFALEGPQGPVRLSQFQDKVVLLFFGFTRCPDVCPTTLLALKRAYEKLPPKAQERVQVIFVSVDPERDPPEVADRYAKAFHPS |||||| ||||| ||||||||| |||||||||||||||| ||||||||||||| ||||||||||| | ..................FALEGP.GPVRL.....KVVLLFFGF....DVCPTTLLALKRAYEK...KAQERVQVIFVSV......PEVADRYAKAF..S --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150-------160-------170-- FLGLSGSPEAVREAAQTFGVFYQKSQYRGPGEYLVDHTATTFVVKEGRLVLLYSPDKAEATDRVVADLQALL |||||| |||||||||||| ||||| ||||||||||||||||||||| |||||||||||| FLGLSG.PEAVREAAQTFG.FYQKS.......YLVDHTATTFVVKEGRLVLLY......ATDRVVADLQAL -------110-------120-------130-------140-------150-------160-------170-