Solution NMR structure of the OB domain of Ta0387 from Thermoplasma acidophilum. Northeast Structural Genomics Consortium target TaR80b.
SDLVKIRDVS LSTPYVSVIG KITGIHKKEY ESDGTTKSVY QGYIEDDTAR IRISSFGKQL QDSDVVRIDN ARVAQFNGYL SLSVGDSSRI ESVNVNIPLE HHHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 97.0 % (1172 of 1208) | 97.6 % (608 of 623) | 95.8 % (453 of 473) | 99.1 % (111 of 112) |
Backbone | 98.7 % (624 of 632) | 99.5 % (216 of 217) | 98.1 % (305 of 311) | 99.0 % (103 of 104) |
Sidechain | 95.9 % (647 of 675) | 96.6 % (392 of 406) | 94.6 % (247 of 261) | 100.0 % (8 of 8) |
Aromatic | 68.2 % (60 of 88) | 68.2 % (30 of 44) | 68.2 % (30 of 44) | |
Methyl | 100.0 % (124 of 124) | 100.0 % (62 of 62) | 100.0 % (62 of 62) |
1. Ta0387
SDLVKIRDVS LSTPYVSVIG KITGIHKKEY ESDGTTKSVY QGYIEDDTAR IRISSFGKQL QDSDVVRIDN ARVAQFNGYL SLSVGDSSRI ESVNVNIPLE HHHHHHSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 4.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | DTT | natural abundance | 10 (±0.5) mM | |
4 | calcium chloride | natural abundance | 5 (±0.05) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 1.0 (±0.1) mM | |
7 | D2O | natural abundance | 5 % | |
8 | H2O | natural abundance | 95 % |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 4.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
10 | sodium chloride | natural abundance | 100 (±5.0) mM | |
11 | DTT | natural abundance | 10 (±0.5) mM | |
12 | calcium chloride | natural abundance | 5 (±0.05) mM | |
13 | sodium azide | natural abundance | 0.02 (±0.001) % | |
14 | protein | [U-5% 13C; U-100% 15N] | 1.3 (±0.1) mM | |
15 | D2O | natural abundance | 5 % | |
16 | H2O | natural abundance | 95 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 4.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
18 | sodium chloride | natural abundance | 100 (±5.0) mM | |
19 | DTT | natural abundance | 10 (±0.5) mM | |
20 | calcium chloride | natural abundance | 5 (±0.05) mM | |
21 | sodium azide | natural abundance | 0.02 (±0.001) % | |
22 | protein | [U-100% 13C; U-100% 15N] | 1.0 (±0.1) mM | |
23 | D2O | natural abundance | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 4.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | DTT | natural abundance | 10 (±0.5) mM | |
4 | calcium chloride | natural abundance | 5 (±0.05) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 1.0 (±0.1) mM | |
7 | D2O | natural abundance | 5 % | |
8 | H2O | natural abundance | 95 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 4.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | DTT | natural abundance | 10 (±0.5) mM | |
4 | calcium chloride | natural abundance | 5 (±0.05) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 1.0 (±0.1) mM | |
7 | D2O | natural abundance | 5 % | |
8 | H2O | natural abundance | 95 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 4.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
10 | sodium chloride | natural abundance | 100 (±5.0) mM | |
11 | DTT | natural abundance | 10 (±0.5) mM | |
12 | calcium chloride | natural abundance | 5 (±0.05) mM | |
13 | sodium azide | natural abundance | 0.02 (±0.001) % | |
14 | protein | [U-5% 13C; U-100% 15N] | 1.3 (±0.1) mM | |
15 | D2O | natural abundance | 5 % | |
16 | H2O | natural abundance | 95 % |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 4.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | DTT | natural abundance | 10 (±0.5) mM | |
4 | calcium chloride | natural abundance | 5 (±0.05) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 1.0 (±0.1) mM | |
7 | D2O | natural abundance | 5 % | |
8 | H2O | natural abundance | 95 % |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 4.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | DTT | natural abundance | 10 (±0.5) mM | |
4 | calcium chloride | natural abundance | 5 (±0.05) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 1.0 (±0.1) mM | |
7 | D2O | natural abundance | 5 % | |
8 | H2O | natural abundance | 95 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 4.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | DTT | natural abundance | 10 (±0.5) mM | |
4 | calcium chloride | natural abundance | 5 (±0.05) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 1.0 (±0.1) mM | |
7 | D2O | natural abundance | 5 % | |
8 | H2O | natural abundance | 95 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 4.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | DTT | natural abundance | 10 (±0.5) mM | |
4 | calcium chloride | natural abundance | 5 (±0.05) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 1.0 (±0.1) mM | |
7 | D2O | natural abundance | 5 % | |
8 | H2O | natural abundance | 95 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 4.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | DTT | natural abundance | 10 (±0.5) mM | |
4 | calcium chloride | natural abundance | 5 (±0.05) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 1.0 (±0.1) mM | |
7 | D2O | natural abundance | 5 % | |
8 | H2O | natural abundance | 95 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 4.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | DTT | natural abundance | 10 (±0.5) mM | |
4 | calcium chloride | natural abundance | 5 (±0.05) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 1.0 (±0.1) mM | |
7 | D2O | natural abundance | 5 % | |
8 | H2O | natural abundance | 95 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 4.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | DTT | natural abundance | 10 (±0.5) mM | |
4 | calcium chloride | natural abundance | 5 (±0.05) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 1.0 (±0.1) mM | |
7 | D2O | natural abundance | 5 % | |
8 | H2O | natural abundance | 95 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 4.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | DTT | natural abundance | 10 (±0.5) mM | |
4 | calcium chloride | natural abundance | 5 (±0.05) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 1.0 (±0.1) mM | |
7 | D2O | natural abundance | 5 % | |
8 | H2O | natural abundance | 95 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 4.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | DTT | natural abundance | 10 (±0.5) mM | |
4 | calcium chloride | natural abundance | 5 (±0.05) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 1.0 (±0.1) mM | |
7 | D2O | natural abundance | 5 % | |
8 | H2O | natural abundance | 95 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 4.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | DTT | natural abundance | 10 (±0.5) mM | |
4 | calcium chloride | natural abundance | 5 (±0.05) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 1.0 (±0.1) mM | |
7 | D2O | natural abundance | 5 % | |
8 | H2O | natural abundance | 95 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 4.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | DTT | natural abundance | 10 (±0.5) mM | |
4 | calcium chloride | natural abundance | 5 (±0.05) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 1.0 (±0.1) mM | |
7 | D2O | natural abundance | 5 % | |
8 | H2O | natural abundance | 95 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 4.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
18 | sodium chloride | natural abundance | 100 (±5.0) mM | |
19 | DTT | natural abundance | 10 (±0.5) mM | |
20 | calcium chloride | natural abundance | 5 (±0.05) mM | |
21 | sodium azide | natural abundance | 0.02 (±0.001) % | |
22 | protein | [U-100% 13C; U-100% 15N] | 1.0 (±0.1) mM | |
23 | D2O | natural abundance | 100 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 4.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
18 | sodium chloride | natural abundance | 100 (±5.0) mM | |
19 | DTT | natural abundance | 10 (±0.5) mM | |
20 | calcium chloride | natural abundance | 5 (±0.05) mM | |
21 | sodium azide | natural abundance | 0.02 (±0.001) % | |
22 | protein | [U-100% 13C; U-100% 15N] | 1.0 (±0.1) mM | |
23 | D2O | natural abundance | 100 % |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 4.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
18 | sodium chloride | natural abundance | 100 (±5.0) mM | |
19 | DTT | natural abundance | 10 (±0.5) mM | |
20 | calcium chloride | natural abundance | 5 (±0.05) mM | |
21 | sodium azide | natural abundance | 0.02 (±0.001) % | |
22 | protein | [U-100% 13C; U-100% 15N] | 1.0 (±0.1) mM | |
23 | D2O | natural abundance | 100 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 4.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
18 | sodium chloride | natural abundance | 100 (±5.0) mM | |
19 | DTT | natural abundance | 10 (±0.5) mM | |
20 | calcium chloride | natural abundance | 5 (±0.05) mM | |
21 | sodium azide | natural abundance | 0.02 (±0.001) % | |
22 | protein | [U-100% 13C; U-100% 15N] | 1.0 (±0.1) mM | |
23 | D2O | natural abundance | 100 % |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 4.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | DTT | natural abundance | 10 (±0.5) mM | |
4 | calcium chloride | natural abundance | 5 (±0.05) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 1.0 (±0.1) mM | |
7 | D2O | natural abundance | 5 % | |
8 | H2O | natural abundance | 95 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 4.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
18 | sodium chloride | natural abundance | 100 (±5.0) mM | |
19 | DTT | natural abundance | 10 (±0.5) mM | |
20 | calcium chloride | natural abundance | 5 (±0.05) mM | |
21 | sodium azide | natural abundance | 0.02 (±0.001) % | |
22 | protein | [U-100% 13C; U-100% 15N] | 1.0 (±0.1) mM | |
23 | D2O | natural abundance | 100 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_15902_2k75.nef |
Input source #2: Coordindates | 2k75.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 SDLVKIRDVSLSTPYVSVIGKITGIHKKEYESDGTTKSVYQGYIEDDTARIRISSFGKQLQDSDVVRIDNARVAQFNGYLSLSVGDSSRIESVNVNIPLE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SDLVKIRDVSLSTPYVSVIGKITGIHKKEYESDGTTKSVYQGYIEDDTARIRISSFGKQLQDSDVVRIDNARVAQFNGYLSLSVGDSSRIESVNVNIPLE ------ HHHHHH |||||| HHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 106 | 0 | 0 | 100.0 |
Content subtype: combined_15902_2k75.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 SDLVKIRDVSLSTPYVSVIGKITGIHKKEYESDGTTKSVYQGYIEDDTARIRISSFGKQLQDSDVVRIDNARVAQFNGYLSLSVGDSSRIESVNVNIPLE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SDLVKIRDVSLSTPYVSVIGKITGIHKKEYESDGTTKSVYQGYIEDDTARIRISSFGKQLQDSDVVRIDNARVAQFNGYLSLSVGDSSRIESVNVNIPLE ------ HHHHHH |||||| HHHHHH
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
7 | ARG | CZ | 159.7 |
41 | GLN | CD | 180.0 |
50 | ARG | CZ | 159.1 |
52 | ARG | CZ | 158.9 |
55 | SER | HG | 6.13 |
59 | GLN | CD | 179.4 |
61 | GLN | CD | 180.6 |
67 | ARG | CZ | 159.3 |
70 | ASN | CG | 177.5 |
72 | ARG | CZ | 159.4 |
75 | GLN | CD | 179.6 |
77 | ASN | CG | 177.7 |
89 | ARG | CZ | 159.5 |
94 | ASN | CG | 177.0 |
96 | ASN | CG | 176.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 623 | 608 | 97.6 |
13C chemical shifts | 473 | 453 | 95.8 |
15N chemical shifts | 118 | 117 | 99.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 217 | 216 | 99.5 |
13C chemical shifts | 212 | 206 | 97.2 |
15N chemical shifts | 104 | 103 | 99.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 406 | 392 | 96.6 |
13C chemical shifts | 261 | 247 | 94.6 |
15N chemical shifts | 14 | 14 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 62 | 62 | 100.0 |
13C chemical shifts | 62 | 62 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 44 | 30 | 68.2 |
13C chemical shifts | 44 | 30 | 68.2 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 SDLVKIRDVSLSTPYVSVIGKITGIHKKEYESDGTTKSVYQGYIEDDTARIRISSFGKQLQDSDVVRIDNARVAQFNGYLSLSVGDSSRIESVNVNIPLE ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SDLVKIRDVSLSTPYVSVIGKITGIHKKEYESDGTTKSVYQGYIEDDTARIRISSFGKQLQDSDVVRIDNARVAQFNGYLSLSVGDSSRIESV --------10--------20--------30--------40--------50--------60--------70--------80--------90--- ------ HHHHHH
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 SDLVKIRDVSLSTPYVSVIGKITGIHKKEYESDGTTKSVYQGYIEDDTARIRISSFGKQLQDSDVVRIDNARVAQFNGYLSLSVGDSSRIESVNVNIPLE ||| ||| || ||| |||| | | | | | |||||||||| | ||||||| |||||| |||| | | |||| | | | ...VKI.DVS..TP.VSV.GKIT..H.K.Y.S..T.KSVYQGYIED..A.IRISSFG......DVVRID.ARVA.F..Y.SLSV....R.E.V --------10--------20--------30--------40--------50--------60--------70--------80--------90--- ------ HHHHHH
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 SDLVKIRDVSLSTPYVSVIGKITGIHKKEYESDGTTKSVYQGYIEDDTARIRISSFGKQLQDSDVVRIDNARVAQFNGYLSLSVGDSSRIESVNVNIPLE |||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||| ||||||||||||||||||||||||||||| .DLVKIRDVSLSTPYVSVIGKITGIHKKEYESDGTTKSVYQGYIEDD.ARIRISSFGKQLQD.DVVRIDNARVAQFNGYLSLSVGDSSRIES --------10--------20--------30--------40--------50--------60--------70--------80--------90-- ------ HHHHHH