Solution NMR structure of protein ATU0232 from AGROBACTERIUM TUMEFACIENS. Northeast Structural Genomics Consortium (NESG) target AtT3. Ontario Center for Structural Proteomics target ATC0223.
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 66.6 % (629 of 944) | 66.6 % (325 of 488) | 66.0 % (243 of 368) | 69.3 % (61 of 88) |
Backbone | 73.1 % (364 of 498) | 72.8 % (126 of 173) | 74.0 % (179 of 242) | 71.1 % (59 of 83) |
Sidechain | 61.3 % (320 of 522) | 63.2 % (199 of 315) | 58.9 % (119 of 202) | 40.0 % (2 of 5) |
Aromatic | 35.6 % (42 of 118) | 45.8 % (27 of 59) | 25.4 % (15 of 59) | |
Methyl | 87.5 % (49 of 56) | 85.7 % (24 of 28) | 89.3 % (25 of 28) |
1. Atc0223
MGSSHHHHHH SSGRENLYFQ GMYKFEIYQD KAGEYRFRFK ASNGETMFSS EGYKAKASAI HAIESIKRNS AGADTVDLTT MTASolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Atc0223 | [U-13C; U-15N] | 0.5 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 500 mM | |
4 | ZnSO4 | natural abundance | 10 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.01 % | |
7 | Benzamidine | natural abundance | 10 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D20 | natural abundance | 10 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | Atc0223 | [U-13C; U-15N] | 0.5 mM | |
11 | TRIS | natural abundance | 10 mM | |
12 | sodium chloride | natural abundance | 500 mM | |
13 | ZnSO4 | natural abundance | 10 uM | |
14 | DTT | natural abundance | 10 mM | |
15 | NaN3 | natural abundance | 0.01 % | |
16 | Benzamidine | natural abundance | 10 mM | |
17 | D20 | natural abundance | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Atc0223 | [U-13C; U-15N] | 0.5 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 500 mM | |
4 | ZnSO4 | natural abundance | 10 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.01 % | |
7 | Benzamidine | natural abundance | 10 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D20 | natural abundance | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Atc0223 | [U-13C; U-15N] | 0.5 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 500 mM | |
4 | ZnSO4 | natural abundance | 10 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.01 % | |
7 | Benzamidine | natural abundance | 10 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D20 | natural abundance | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Atc0223 | [U-13C; U-15N] | 0.5 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 500 mM | |
4 | ZnSO4 | natural abundance | 10 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.01 % | |
7 | Benzamidine | natural abundance | 10 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D20 | natural abundance | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Atc0223 | [U-13C; U-15N] | 0.5 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 500 mM | |
4 | ZnSO4 | natural abundance | 10 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.01 % | |
7 | Benzamidine | natural abundance | 10 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D20 | natural abundance | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Atc0223 | [U-13C; U-15N] | 0.5 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 500 mM | |
4 | ZnSO4 | natural abundance | 10 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.01 % | |
7 | Benzamidine | natural abundance | 10 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D20 | natural abundance | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Atc0223 | [U-13C; U-15N] | 0.5 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 500 mM | |
4 | ZnSO4 | natural abundance | 10 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.01 % | |
7 | Benzamidine | natural abundance | 10 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D20 | natural abundance | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | Atc0223 | [U-13C; U-15N] | 0.5 mM | |
11 | TRIS | natural abundance | 10 mM | |
12 | sodium chloride | natural abundance | 500 mM | |
13 | ZnSO4 | natural abundance | 10 uM | |
14 | DTT | natural abundance | 10 mM | |
15 | NaN3 | natural abundance | 0.01 % | |
16 | Benzamidine | natural abundance | 10 mM | |
17 | D20 | natural abundance | 100 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | Atc0223 | [U-13C; U-15N] | 0.5 mM | |
11 | TRIS | natural abundance | 10 mM | |
12 | sodium chloride | natural abundance | 500 mM | |
13 | ZnSO4 | natural abundance | 10 uM | |
14 | DTT | natural abundance | 10 mM | |
15 | NaN3 | natural abundance | 0.01 % | |
16 | Benzamidine | natural abundance | 10 mM | |
17 | D20 | natural abundance | 100 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Atc0223 | [U-13C; U-15N] | 0.5 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 500 mM | |
4 | ZnSO4 | natural abundance | 10 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.01 % | |
7 | Benzamidine | natural abundance | 10 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D20 | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Atc0223 | [U-13C; U-15N] | 0.5 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 500 mM | |
4 | ZnSO4 | natural abundance | 10 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.01 % | |
7 | Benzamidine | natural abundance | 10 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D20 | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | Atc0223 | [U-13C; U-15N] | 0.5 mM | |
11 | TRIS | natural abundance | 10 mM | |
12 | sodium chloride | natural abundance | 500 mM | |
13 | ZnSO4 | natural abundance | 10 uM | |
14 | DTT | natural abundance | 10 mM | |
15 | NaN3 | natural abundance | 0.01 % | |
16 | Benzamidine | natural abundance | 10 mM | |
17 | D20 | natural abundance | 100 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Atc0223 | [U-13C; U-15N] | 0.5 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 500 mM | |
4 | ZnSO4 | natural abundance | 10 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.01 % | |
7 | Benzamidine | natural abundance | 10 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D20 | natural abundance | 10 % |
Varian INOVA - 600 MHz
State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Atc0223 | [U-13C; U-15N] | 0.5 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 500 mM | |
4 | ZnSO4 | natural abundance | 10 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.01 % | |
7 | Benzamidine | natural abundance | 10 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D20 | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_15916_2k7i.nef |
Input source #2: Coordindates | 2k7i.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-----------------------------10--------20--------30--------40--------50--------60-- MGSSHHHHHHSSGRENLYFQGMYKFEIYQDKAGEYRFRFKASNGETMFSSEGYKAKASAIHAIESIKRNSAGADTVDLTTMTA ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGSSHHHHHHSSGRENLYFQGMYKFEIYQDKAGEYRFRFKASNGETMFSSEGYKAKASAIHAIESIKRNSAGADTVDLTTMTA --------10--------20--------30--------40--------50--------60--------70--------80---
-----------------------------10--------20--------30--------40--------50--------60-- MGSSHHHHHHSSGRENLYFQGMYKFEIYQDKAGEYRFRFKASNGETMFSSEGYKAKASAIHAIESIKRNSAGADTVDLTTMTA ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGSSHHHHHHSSGRENLYFQGMYKFEIYQDKAGEYRFRFKASNGETMFSSEGYKAKASAIHAIESIKRNSAGADTVDLTTMTA --------10--------20--------30--------40--------50--------60--------70--------80---
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 83 | 0 | 0 | 100.0 |
B | B | 83 | 0 | 0 | 100.0 |
Content subtype: combined_15916_2k7i.nef
Assigned chemical shifts
-----------------------------10--------20--------30--------40--------50--------60-- MGSSHHHHHHSSGRENLYFQGMYKFEIYQDKAGEYRFRFKASNGETMFSSEGYKAKASAIHAIESIKRNSAGADTVDLTTMTA ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| || .....................MYKFEIYQDKAGEYRFRFKASNGETMFSSEGYKAKASAIHAIESIKRNSAGADTVDLTT.TA
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 488 | 316 | 64.8 |
13C chemical shifts | 368 | 235 | 63.9 |
15N chemical shifts | 92 | 59 | 64.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 173 | 121 | 69.9 |
13C chemical shifts | 166 | 120 | 72.3 |
15N chemical shifts | 83 | 56 | 67.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 315 | 195 | 61.9 |
13C chemical shifts | 202 | 115 | 56.9 |
15N chemical shifts | 9 | 3 | 33.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 32 | 27 | 84.4 |
13C chemical shifts | 32 | 27 | 84.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 59 | 27 | 45.8 |
13C chemical shifts | 59 | 15 | 25.4 |
Distance restraints
-----------------------------10--------20--------30--------40--------50--------60-- MGSSHHHHHHSSGRENLYFQGMYKFEIYQDKAGEYRFRFKASNGETMFSSEGYKAKASAIHAIESIKRNSAGADTVDLTTMTA ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| || .....................MYKFEIYQDKAGEYRFRFKASNGETMFSSEGYKAKASAIHAIESIKRNSAGADTVDLTT.TA
-----------------------------10--------20--------30--------40--------50--------60-- MGSSHHHHHHSSGRENLYFQGMYKFEIYQDKAGEYRFRFKASNGETMFSSEGYKAKASAIHAIESIKRNSAGADTVDLTTMTA ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| || .....................MYKFEIYQDKAGEYRFRFKASNGETMFSSEGYKAKASAIHAIESIKRNSAGADTVDLTT.TA
Dihedral angle restraints
-----------------------------10--------20--------30--------40--------50--------60-- MGSSHHHHHHSSGRENLYFQGMYKFEIYQDKAGEYRFRFKASNGETMFSSEGYKAKASAIHAIESIKRNSAGADTVDLTTMTA ||||||||| ||||||||||||||||||| |||||||||||||||||||||||||| ......................YKFEIYQDK...YRFRFKASNGETMFSSEGY.AKASAIHAIESIKRNSAGADTVDLTT -----------------------------10--------20--------30--------40--------50---------
-----------------------------10--------20--------30--------40--------50--------60-- MGSSHHHHHHSSGRENLYFQGMYKFEIYQDKAGEYRFRFKASNGETMFSSEGYKAKASAIHAIESIKRNSAGADTVDLTTMTA ||||||||| ||||||||||||||||||| |||||||||||||||||||||||||| ......................YKFEIYQDK...YRFRFKASNGETMFSSEGY.AKASAIHAIESIKRNSAGADTVDLTT -----------------------------10--------20--------30--------40--------50---------
RDC restraints
-----------------------------10--------20--------30--------40--------50--------60-- MGSSHHHHHHSSGRENLYFQGMYKFEIYQDKAGEYRFRFKASNGETMFSSEGYKAKASAIHAIESIKRNSAGADTVDLTTMTA ||||||| ||||| ||||| || | || || ||||| || ||||||||| |||||| .......................KFEIYQD.AGEYR.RFKAS.GE.M.SS.GY..KASAI.AI.SIKRNSAGA.TVDLTT -----------------------------10--------20--------30--------40--------50---------
-----------------------------10--------20--------30--------40--------50--------60-- MGSSHHHHHHSSGRENLYFQGMYKFEIYQDKAGEYRFRFKASNGETMFSSEGYKAKASAIHAIESIKRNSAGADTVDLTTMTA ||||||| ||||| ||||| || | || || ||||| || ||||||||| |||||| .......................KFEIYQD.AGEYR.RFKAS.GE.M.SS.GY..KASAI.AI.SIKRNSAGA.TVDLTT -----------------------------10--------20--------30--------40--------50---------