Filamin A Ig-like domains 16-17
GAMAPERPLV GVNGLDVTSL RPFDLVIPFT IKKGEITGEV RMPSGKVAQP TITDNKDGTV TVRYAPSEAG LHEMDIRYDN MHIPGSPLQF YVDYVNCGHV TAYGPGLTHG VVNKPATFTV NTKDAGEGGL SLAIEGPSKA EISCTDNQDG TCSVSYLPVL PGDYSILVKY NEQHVPGSPF TARVTGDD
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 89.8 % (1848 of 2057) | 98.3 % (1039 of 1057) | 77.2 % (630 of 816) | 97.3 % (179 of 184) |
Backbone | 85.5 % (937 of 1096) | 99.0 % (377 of 381) | 72.2 % (392 of 543) | 97.7 % (168 of 172) |
Sidechain | 95.6 % (1078 of 1128) | 97.9 % (662 of 676) | 92.0 % (405 of 440) | 91.7 % (11 of 12) |
Aromatic | 79.1 % (106 of 134) | 98.5 % (66 of 67) | 59.7 % (40 of 67) | |
Methyl | 98.1 % (210 of 214) | 100.0 % (107 of 107) | 96.3 % (103 of 107) |
1. FLNa16-17
GAMAPERPLV GVNGLDVTSL RPFDLVIPFT IKKGEITGEV RMPSGKVAQP TITDNKDGTV TVRYAPSEAG LHEMDIRYDN MHIPGSPLQF YVDYVNCGHV TAYGPGLTHG VVNKPATFTV NTKDAGEGGL SLAIEGPSKA EISCTDNQDG TCSVSYLPVL PGDYSILVKY NEQHVPGSPF TARVTGDDSolvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303.15 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FLNa16-17 | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 2 mM | |
6 | EDTA | natural abundance | 2 mM | |
7 | H2O | natural abundance | 93 % | |
8 | D2O | [U-100% 2H] | 7 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TSP | methyl carbon | 0.0 ppm | internal | direct | 0.2514495 |
1H | TSP | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | water | protons | 4.727517 ppm | internal | indirect | 0.101329 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TSP | methyl carbon | 0.0 ppm | internal | direct | 0.2514495 |
1H | TSP | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | water | protons | 4.727517 ppm | internal | indirect | 0.101329 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TSP | methyl carbon | 0.0 ppm | internal | direct | 0.2514495 |
1H | TSP | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | water | protons | 4.727517 ppm | internal | indirect | 0.101329 |
Varian INOVA - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303.15 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FLNa16-17 | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 2 mM | |
6 | EDTA | natural abundance | 2 mM | |
7 | H2O | natural abundance | 93 % | |
8 | D2O | [U-100% 2H] | 7 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303.15 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FLNa16-17 | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 2 mM | |
6 | EDTA | natural abundance | 2 mM | |
7 | H2O | natural abundance | 93 % | |
8 | D2O | [U-100% 2H] | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303.15 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FLNa16-17 | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 2 mM | |
6 | EDTA | natural abundance | 2 mM | |
7 | H2O | natural abundance | 93 % | |
8 | D2O | [U-100% 2H] | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303.15 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FLNa16-17 | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 2 mM | |
6 | EDTA | natural abundance | 2 mM | |
7 | H2O | natural abundance | 93 % | |
8 | D2O | [U-100% 2H] | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303.15 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FLNa16-17 | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 2 mM | |
6 | EDTA | natural abundance | 2 mM | |
7 | H2O | natural abundance | 93 % | |
8 | D2O | [U-100% 2H] | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303.15 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FLNa16-17 | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 2 mM | |
6 | EDTA | natural abundance | 2 mM | |
7 | H2O | natural abundance | 93 % | |
8 | D2O | [U-100% 2H] | 7 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303.15 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FLNa16-17 | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 2 mM | |
6 | EDTA | natural abundance | 2 mM | |
7 | H2O | natural abundance | 93 % | |
8 | D2O | [U-100% 2H] | 7 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303.15 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FLNa16-17 | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 2 mM | |
6 | EDTA | natural abundance | 2 mM | |
7 | H2O | natural abundance | 93 % | |
8 | D2O | [U-100% 2H] | 7 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303.15 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FLNa16-17 | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 2 mM | |
6 | EDTA | natural abundance | 2 mM | |
7 | H2O | natural abundance | 93 % | |
8 | D2O | [U-100% 2H] | 7 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303.15 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FLNa16-17 | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 2 mM | |
6 | EDTA | natural abundance | 2 mM | |
7 | H2O | natural abundance | 93 % | |
8 | D2O | [U-100% 2H] | 7 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303.15 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FLNa16-17 | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 2 mM | |
6 | EDTA | natural abundance | 2 mM | |
7 | H2O | natural abundance | 93 % | |
8 | D2O | [U-100% 2H] | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303.15 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FLNa16-17 | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 2 mM | |
6 | EDTA | natural abundance | 2 mM | |
7 | H2O | natural abundance | 93 % | |
8 | D2O | [U-100% 2H] | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303.15 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FLNa16-17 | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 2 mM | |
6 | EDTA | natural abundance | 2 mM | |
7 | H2O | natural abundance | 93 % | |
8 | D2O | [U-100% 2H] | 7 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_15924_2k7p.nef |
Input source #2: Coordindates | 2k7p.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------1780------1790------1800------1810------1820------1830------1840------1850------1860------18 GAMAPERPLVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPTITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCGHV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GAMAPERPLVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPTITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCGHV --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 70------1880------1890------1900------1910------1920------1930------1940------1950------ TAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNEQHVPGSPFTARVTGDD |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| TAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNEQHVPGSPFTARVTGDD -------110-------120-------130-------140-------150-------160-------170-------180--------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 188 | 0 | 0 | 100.0 |
Content subtype: combined_15924_2k7p.nef
Assigned chemical shifts
--------1780------1790------1800------1810------1820------1830------1840------1850------1860------18 GAMAPERPLVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPTITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCGHV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GAMAPERPLVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPTITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCGHV 70------1880------1890------1900------1910------1920------1930------1940------1950------ TAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNEQHVPGSPFTARVTGDD |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| TAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNEQHVPGSPFTARVTGDD
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
1840 | HIS | HD1 | 10.5 |
1840 | HIS | ND1 | 166.303 |
1924 | TYR | HH | 8.249 |
1932 | TYR | HH | 10.074 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 1057 | 1037 | 98.1 |
13C chemical shifts | 816 | 591 | 72.4 |
15N chemical shifts | 190 | 182 | 95.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 381 | 376 | 98.7 |
13C chemical shifts | 376 | 188 | 50.0 |
15N chemical shifts | 172 | 167 | 97.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 676 | 661 | 97.8 |
13C chemical shifts | 440 | 403 | 91.6 |
15N chemical shifts | 18 | 15 | 83.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 111 | 111 | 100.0 |
13C chemical shifts | 111 | 105 | 94.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 67 | 66 | 98.5 |
13C chemical shifts | 67 | 40 | 59.7 |
Distance restraints
--------1780------1790------1800------1810------1820------1830------1840------1850------1860------18 GAMAPERPLVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPTITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCGHV ||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...APERPLVGV.GLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPTITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCGHV -1770---1780------1790------1800------1810------1820------1830------1840------1850------1860------18 70------1880------1890------1900------1910------1920------1930------1940------1950------ TAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNEQHVPGSPFTARVTGDD |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| TAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNEQHVPGSPFTARVTGDD 70------1880------1890------1900------1910------1920------1930------1940------1950------
Dihedral angle restraints
--------1780------1790------1800------1810------1820------1830------1840------1850------1860------18 GAMAPERPLVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPTITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCGHV ||||||||||||| |||||||||| |||||||||| ||||||||||||||||||||||||| |||||||| || ...................LRPFDLVIPFTIK.GEITGEVRMP..KVAQPTITDN..GTVTVRYAPSEAGLHEMDIRYDNMH....PLQFYVDY....HV -1770---1780------1790------1800------1810------1820------1830------1840------1850------1860------18 70------1880------1890------1900------1910------1920------1930------1940------1950------ TAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNEQHVPGSPFTARVTGDD |||| ||||||||||||||||| |||||||| |||||||||| ||||||||| ||||||||||||| |||||||| TAYG...THGVVNKPATFTVNTKD....GLSLAIEG.SKAEISCTDN..GTCSVSYLP....DYSILVKYNEQHV...PFTARVTG 70------1880------1890------1900------1910------1920------1930------1940------1950----