Human ARNT C-Terminal PAS Domain, 3 Residue IB slip
GAMDNVCQPT EFISRHNIEG IFTFVDHRCV ATVGYQPQEL LGKNIVEFCH PEDQQLLRDS FQQVVKLKGQ VLSVMFRFRS KNQEWLWMRT SSQTAQNPYS DEIETIICTN TNVKNSSQE
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 89.7 % (1277 of 1424) | 88.7 % (660 of 744) | 91.5 % (497 of 543) | 87.6 % (120 of 137) |
Backbone | 90.8 % (641 of 706) | 90.8 % (217 of 239) | 90.1 % (317 of 352) | 93.0 % (107 of 115) |
Sidechain | 89.4 % (744 of 832) | 87.7 % (443 of 505) | 94.4 % (288 of 305) | 59.1 % (13 of 22) |
Aromatic | 97.5 % (119 of 122) | 98.4 % (60 of 61) | 96.6 % (57 of 59) | 100.0 % (2 of 2) |
Methyl | 96.6 % (114 of 118) | 96.6 % (57 of 59) | 96.6 % (57 of 59) |
1. ARNT PAS-B Slipped IB Strand
GAMDNVCQPT EFISRHNIEG IFTFVDHRCV ATVGYQPQEL LGKNIVEFCH PEDQQLLRDS FQQVVKLKGQ VLSVMFRFRS KNQEWLWMRT SSQTAQNPYS DEIETIICTN TNVKNSSQESolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 5mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ARNT PAS-B Slipped IB Strand | [U-98% 13C; U-98% 15N] | 900 uM | |
2 | TRIS | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 17 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | [U-100% 2H] | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 5mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ARNT PAS-B Slipped IB Strand | [U-98% 13C; U-98% 15N] | 900 uM | |
2 | TRIS | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 17 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | [U-100% 2H] | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 5mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ARNT PAS-B Slipped IB Strand | [U-98% 13C; U-98% 15N] | 900 uM | |
2 | TRIS | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 17 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | [U-100% 2H] | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 5mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ARNT PAS-B Slipped IB Strand | [U-98% 13C; U-98% 15N] | 900 uM | |
2 | TRIS | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 17 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | [U-100% 2H] | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 5mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ARNT PAS-B Slipped IB Strand | [U-98% 13C; U-98% 15N] | 900 uM | |
2 | TRIS | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 17 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | [U-100% 2H] | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 5mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ARNT PAS-B Slipped IB Strand | [U-98% 13C; U-98% 15N] | 900 uM | |
2 | TRIS | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 17 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | [U-100% 2H] | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 5mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ARNT PAS-B Slipped IB Strand | [U-98% 13C; U-98% 15N] | 900 uM | |
2 | TRIS | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 17 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | [U-100% 2H] | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 5mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ARNT PAS-B Slipped IB Strand | [U-98% 13C; U-98% 15N] | 900 uM | |
2 | TRIS | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 17 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | [U-100% 2H] | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 5mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ARNT PAS-B Slipped IB Strand | [U-98% 13C; U-98% 15N] | 900 uM | |
2 | TRIS | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 17 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | [U-100% 2H] | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 5mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ARNT PAS-B Slipped IB Strand | [U-98% 13C; U-98% 15N] | 900 uM | |
2 | TRIS | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 17 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | [U-100% 2H] | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_15928_2k7s.nef |
Input source #2: Coordindates | 2k7s.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GAMDNVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSQTAQNPYS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GAMDNVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSQTAQNPYS -------110--------- DEIETIICTNTNVKNSSQE ||||||||||||||||||| DEIETIICTNTNVKNSSQE
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 119 | 0 | 0 | 100.0 |
Content subtype: combined_15928_2k7s.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GAMDNVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSQTAQNPYS |||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .AMDNVC.PTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSQTAQNPYS -------110--------- DEIETIICTNTNVKNSSQE |||||||||||| ||| DEIETIICTNTN....SQE
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
16 | HIS | HD1 | 10.249 |
16 | HIS | HE2 | 10.015 |
16 | HIS | ND1 | 162.709 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 744 | 650 | 87.4 |
13C chemical shifts | 543 | 492 | 90.6 |
15N chemical shifts | 143 | 121 | 84.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 239 | 215 | 90.0 |
13C chemical shifts | 238 | 208 | 87.4 |
15N chemical shifts | 115 | 106 | 92.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 505 | 435 | 86.1 |
13C chemical shifts | 305 | 284 | 93.1 |
15N chemical shifts | 28 | 15 | 53.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 62 | 60 | 96.8 |
13C chemical shifts | 62 | 60 | 96.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 61 | 59 | 96.7 |
13C chemical shifts | 59 | 57 | 96.6 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GAMDNVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSQTAQNPYS | || ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..M.NV.QPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSQTAQNPYS --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110--------- DEIETIICTNTNVKNSSQE ||||||||||| DEIETIICTNT -------110-
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GAMDNVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSQTAQNPYS || || ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .AM.NV.QPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSQTAQNPYS -------110--------- DEIETIICTNTNVKNSSQE ||||||||||| | DEIETIICTNT.......E
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GAMDNVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSQTAQNPYS |||||| ||||| | || || | |||||||||||| |||||||||||| | | | | ||| | |||||||| ...........FISRHN..GIFTF.D.RC..TV...P..LLGKNIVEFCHP.DQQLLRDSFQQV..L....L.V.F.FRS...E.LWMRTSSQ....... --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110--------- DEIETIICTNTNVKNSSQE |||||| | ..IETIIC.N -------110
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GAMDNVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSQTAQNPYS ||||||||||| |||||||||||| ||||| ||||||| ||||||||||||||||| |||||||||||||||||||||||||| .........TEFISRHNIEG..TFVDHRCVATVG.QPQEL.GKNIVEF..PEDQQLLRDSFQQVVKL.GQVLSVMFRFRSKNQEWLWMRTSSQT...... --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110--------- DEIETIICTNTNVKNSSQE |||||||| .EIETIICT ---------