Structural Basis for the Regulation of p53 Function by p300
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 84.9 % (1277 of 1504) | 82.2 % (657 of 799) | 89.4 % (508 of 568) | 81.8 % (112 of 137) |
Backbone | 94.5 % (709 of 750) | 94.0 % (235 of 250) | 94.8 % (363 of 383) | 94.9 % (111 of 117) |
Sidechain | 78.5 % (690 of 879) | 76.9 % (422 of 549) | 86.1 % (267 of 310) | 5.0 % (1 of 20) |
Aromatic | 0.0 % (0 of 56) | 0.0 % (0 of 28) | 0.0 % (0 of 27) | 0.0 % (0 of 1) |
Methyl | 87.5 % (105 of 120) | 86.7 % (52 of 60) | 88.3 % (53 of 60) |
1. TAZ2
ATQSPGDSRR LSIQRAIQSL VHAAQCRNAN CSLPSCQKMK RVVQHTKGCK RKTNGGCPIC KQLIALAAYH AKHCQENKCP VPFCLNIKQK2. TAD(1-39)
MEEPQSDPSV EPPLSQETFS DLWKLLPENN VLSPLPSQASolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.3, Details 15N and/or 13C labeled p53(1-39) with non-labeled TAZ2 complex in 50 mM MES, 200 mM NaCl, 0.1 mM ZnCl, 1mM DTT, pH 6.3.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TAZ2 | natural abundance | 1.1-1.2 mM | |
2 | TAD(1-39) | [U-100% 15N] | 1.0-1.1 mM | |
3 | MES | natural abundance | 50 mM | |
4 | NaCl | natural abundance | 200 mM | |
5 | ZnCl | natural abundance | 0.1 mM | |
6 | DTT | natural abundance | 1 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.3, Details 15N labeled TAZ2 and non-labeled TAD(1-39) complex.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | TAZ2 | [U-100% 15N] | 1.0-1.2 mM | |
8 | TAD(1-39) | natural abundance | 1.1-1.3 mM | |
9 | MES | natural abundance | 50 mM | |
10 | NaCl | natural abundance | 200 mM | |
11 | ZnCl | natural abundance | 0.1 mM | |
12 | DTT | natural abundance | 1 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.3, Details 15N and 13C labeled TAZ2 and non-labeled TAD(1-39) complex.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | TAZ2 | [U-100% 13C; U-100% 15N] | 1.0-1.2 mM | |
14 | TAD(1-39) | natural abundance | 1.1-1.3 mM | |
15 | MES | natural abundance | 50 mM | |
16 | NaCl | natural abundance | 200 mM | |
17 | ZnCl | natural abundance | 0.1 mM | |
18 | DTT | natural abundance | 1 mM |
Solvent system 100% D2O, Pressure 1 atm, Temperature 308 K, pH 6.3, Details non-labeled TAZ2 and non-labeled TAD(1-39) complex.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
19 | TAZ2 | natural abundance | 1.0-1.2 mM | |
20 | TAD(1-39) | natural abundance | 1.1-1.3 mM | |
21 | MES | natural abundance | 50 mM | |
22 | NaCl | natural abundance | 200 mM | |
23 | ZnCl | natural abundance | 0.1 mM | |
24 | DTT | natural abundance | 1 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | na | na | 0.0 ppm | null | null | 0.0 |
1H | na | na | 0.0 ppm | null | null | 0.0 |
15N | na | na | 0.0 ppm | null | null | 0.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | na | na | 0.0 ppm | null | null | 0.0 |
1H | na | na | 0.0 ppm | null | null | 0.0 |
15N | na | na | 0.0 ppm | null | null | 0.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | na | na | 0.0 ppm | null | null | 0.0 |
1H | na | na | 0.0 ppm | null | null | 0.0 |
15N | na | na | 0.0 ppm | null | null | 0.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | na | na | 0.0 ppm | null | null | 0.0 |
1H | na | na | 0.0 ppm | null | null | 0.0 |
15N | na | na | 0.0 ppm | null | null | 0.0 |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.3, Details 15N labeled TAZ2 and non-labeled TAD(1-39) complex.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | TAZ2 | [U-100% 15N] | 1.0-1.2 mM | |
8 | TAD(1-39) | natural abundance | 1.1-1.3 mM | |
9 | MES | natural abundance | 50 mM | |
10 | NaCl | natural abundance | 200 mM | |
11 | ZnCl | natural abundance | 0.1 mM | |
12 | DTT | natural abundance | 1 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 308 K, pH 6.3, Details non-labeled TAZ2 and non-labeled TAD(1-39) complex.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
19 | TAZ2 | natural abundance | 1.0-1.2 mM | |
20 | TAD(1-39) | natural abundance | 1.1-1.3 mM | |
21 | MES | natural abundance | 50 mM | |
22 | NaCl | natural abundance | 200 mM | |
23 | ZnCl | natural abundance | 0.1 mM | |
24 | DTT | natural abundance | 1 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.3, Details 15N and 13C labeled TAZ2 and non-labeled TAD(1-39) complex.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | TAZ2 | [U-100% 13C; U-100% 15N] | 1.0-1.2 mM | |
14 | TAD(1-39) | natural abundance | 1.1-1.3 mM | |
15 | MES | natural abundance | 50 mM | |
16 | NaCl | natural abundance | 200 mM | |
17 | ZnCl | natural abundance | 0.1 mM | |
18 | DTT | natural abundance | 1 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.3, Details 15N and 13C labeled TAZ2 and non-labeled TAD(1-39) complex.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | TAZ2 | [U-100% 13C; U-100% 15N] | 1.0-1.2 mM | |
14 | TAD(1-39) | natural abundance | 1.1-1.3 mM | |
15 | MES | natural abundance | 50 mM | |
16 | NaCl | natural abundance | 200 mM | |
17 | ZnCl | natural abundance | 0.1 mM | |
18 | DTT | natural abundance | 1 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.3, Details 15N and 13C labeled TAZ2 and non-labeled TAD(1-39) complex.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | TAZ2 | [U-100% 13C; U-100% 15N] | 1.0-1.2 mM | |
14 | TAD(1-39) | natural abundance | 1.1-1.3 mM | |
15 | MES | natural abundance | 50 mM | |
16 | NaCl | natural abundance | 200 mM | |
17 | ZnCl | natural abundance | 0.1 mM | |
18 | DTT | natural abundance | 1 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.3, Details 15N and 13C labeled TAZ2 and non-labeled TAD(1-39) complex.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | TAZ2 | [U-100% 13C; U-100% 15N] | 1.0-1.2 mM | |
14 | TAD(1-39) | natural abundance | 1.1-1.3 mM | |
15 | MES | natural abundance | 50 mM | |
16 | NaCl | natural abundance | 200 mM | |
17 | ZnCl | natural abundance | 0.1 mM | |
18 | DTT | natural abundance | 1 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.3, Details 15N and 13C labeled TAZ2 and non-labeled TAD(1-39) complex.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | TAZ2 | [U-100% 13C; U-100% 15N] | 1.0-1.2 mM | |
14 | TAD(1-39) | natural abundance | 1.1-1.3 mM | |
15 | MES | natural abundance | 50 mM | |
16 | NaCl | natural abundance | 200 mM | |
17 | ZnCl | natural abundance | 0.1 mM | |
18 | DTT | natural abundance | 1 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.3, Details 15N and 13C labeled TAZ2 and non-labeled TAD(1-39) complex.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | TAZ2 | [U-100% 13C; U-100% 15N] | 1.0-1.2 mM | |
14 | TAD(1-39) | natural abundance | 1.1-1.3 mM | |
15 | MES | natural abundance | 50 mM | |
16 | NaCl | natural abundance | 200 mM | |
17 | ZnCl | natural abundance | 0.1 mM | |
18 | DTT | natural abundance | 1 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.3, Details 15N and 13C labeled TAZ2 and non-labeled TAD(1-39) complex.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | TAZ2 | [U-100% 13C; U-100% 15N] | 1.0-1.2 mM | |
14 | TAD(1-39) | natural abundance | 1.1-1.3 mM | |
15 | MES | natural abundance | 50 mM | |
16 | NaCl | natural abundance | 200 mM | |
17 | ZnCl | natural abundance | 0.1 mM | |
18 | DTT | natural abundance | 1 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.3, Details 15N labeled TAZ2 and non-labeled TAD(1-39) complex.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | TAZ2 | [U-100% 15N] | 1.0-1.2 mM | |
8 | TAD(1-39) | natural abundance | 1.1-1.3 mM | |
9 | MES | natural abundance | 50 mM | |
10 | NaCl | natural abundance | 200 mM | |
11 | ZnCl | natural abundance | 0.1 mM | |
12 | DTT | natural abundance | 1 mM |
Bruker DRX - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.3, Details 15N labeled TAZ2 and non-labeled TAD(1-39) complex.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | TAZ2 | [U-100% 15N] | 1.0-1.2 mM | |
8 | TAD(1-39) | natural abundance | 1.1-1.3 mM | |
9 | MES | natural abundance | 50 mM | |
10 | NaCl | natural abundance | 200 mM | |
11 | ZnCl | natural abundance | 0.1 mM | |
12 | DTT | natural abundance | 1 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.3, Details 15N and 13C labeled TAZ2 and non-labeled TAD(1-39) complex.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | TAZ2 | [U-100% 13C; U-100% 15N] | 1.0-1.2 mM | |
14 | TAD(1-39) | natural abundance | 1.1-1.3 mM | |
15 | MES | natural abundance | 50 mM | |
16 | NaCl | natural abundance | 200 mM | |
17 | ZnCl | natural abundance | 0.1 mM | |
18 | DTT | natural abundance | 1 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.3, Details 15N and/or 13C labeled p53(1-39) with non-labeled TAZ2 complex in 50 mM MES, 200 mM NaCl, 0.1 mM ZnCl, 1mM DTT, pH 6.3.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TAZ2 | natural abundance | 1.1-1.2 mM | |
2 | TAD(1-39) | [U-100% 15N] | 1.0-1.1 mM | |
3 | MES | natural abundance | 50 mM | |
4 | NaCl | natural abundance | 200 mM | |
5 | ZnCl | natural abundance | 0.1 mM | |
6 | DTT | natural abundance | 1 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.3, Details 15N and/or 13C labeled p53(1-39) with non-labeled TAZ2 complex in 50 mM MES, 200 mM NaCl, 0.1 mM ZnCl, 1mM DTT, pH 6.3.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TAZ2 | natural abundance | 1.1-1.2 mM | |
2 | TAD(1-39) | [U-100% 15N] | 1.0-1.1 mM | |
3 | MES | natural abundance | 50 mM | |
4 | NaCl | natural abundance | 200 mM | |
5 | ZnCl | natural abundance | 0.1 mM | |
6 | DTT | natural abundance | 1 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.3, Details 15N and/or 13C labeled p53(1-39) with non-labeled TAZ2 complex in 50 mM MES, 200 mM NaCl, 0.1 mM ZnCl, 1mM DTT, pH 6.3.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TAZ2 | natural abundance | 1.1-1.2 mM | |
2 | TAD(1-39) | [U-100% 15N] | 1.0-1.1 mM | |
3 | MES | natural abundance | 50 mM | |
4 | NaCl | natural abundance | 200 mM | |
5 | ZnCl | natural abundance | 0.1 mM | |
6 | DTT | natural abundance | 1 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.3, Details 15N and/or 13C labeled p53(1-39) with non-labeled TAZ2 complex in 50 mM MES, 200 mM NaCl, 0.1 mM ZnCl, 1mM DTT, pH 6.3.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TAZ2 | natural abundance | 1.1-1.2 mM | |
2 | TAD(1-39) | [U-100% 15N] | 1.0-1.1 mM | |
3 | MES | natural abundance | 50 mM | |
4 | NaCl | natural abundance | 200 mM | |
5 | ZnCl | natural abundance | 0.1 mM | |
6 | DTT | natural abundance | 1 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.3, Details 15N and/or 13C labeled p53(1-39) with non-labeled TAZ2 complex in 50 mM MES, 200 mM NaCl, 0.1 mM ZnCl, 1mM DTT, pH 6.3.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TAZ2 | natural abundance | 1.1-1.2 mM | |
2 | TAD(1-39) | [U-100% 15N] | 1.0-1.1 mM | |
3 | MES | natural abundance | 50 mM | |
4 | NaCl | natural abundance | 200 mM | |
5 | ZnCl | natural abundance | 0.1 mM | |
6 | DTT | natural abundance | 1 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.3, Details 15N and/or 13C labeled p53(1-39) with non-labeled TAZ2 complex in 50 mM MES, 200 mM NaCl, 0.1 mM ZnCl, 1mM DTT, pH 6.3.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TAZ2 | natural abundance | 1.1-1.2 mM | |
2 | TAD(1-39) | [U-100% 15N] | 1.0-1.1 mM | |
3 | MES | natural abundance | 50 mM | |
4 | NaCl | natural abundance | 200 mM | |
5 | ZnCl | natural abundance | 0.1 mM | |
6 | DTT | natural abundance | 1 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.3, Details 15N and/or 13C labeled p53(1-39) with non-labeled TAZ2 complex in 50 mM MES, 200 mM NaCl, 0.1 mM ZnCl, 1mM DTT, pH 6.3.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TAZ2 | natural abundance | 1.1-1.2 mM | |
2 | TAD(1-39) | [U-100% 15N] | 1.0-1.1 mM | |
3 | MES | natural abundance | 50 mM | |
4 | NaCl | natural abundance | 200 mM | |
5 | ZnCl | natural abundance | 0.1 mM | |
6 | DTT | natural abundance | 1 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.3, Details 15N and/or 13C labeled p53(1-39) with non-labeled TAZ2 complex in 50 mM MES, 200 mM NaCl, 0.1 mM ZnCl, 1mM DTT, pH 6.3.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TAZ2 | natural abundance | 1.1-1.2 mM | |
2 | TAD(1-39) | [U-100% 15N] | 1.0-1.1 mM | |
3 | MES | natural abundance | 50 mM | |
4 | NaCl | natural abundance | 200 mM | |
5 | ZnCl | natural abundance | 0.1 mM | |
6 | DTT | natural abundance | 1 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.3, Details 15N and/or 13C labeled p53(1-39) with non-labeled TAZ2 complex in 50 mM MES, 200 mM NaCl, 0.1 mM ZnCl, 1mM DTT, pH 6.3.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TAZ2 | natural abundance | 1.1-1.2 mM | |
2 | TAD(1-39) | [U-100% 15N] | 1.0-1.1 mM | |
3 | MES | natural abundance | 50 mM | |
4 | NaCl | natural abundance | 200 mM | |
5 | ZnCl | natural abundance | 0.1 mM | |
6 | DTT | natural abundance | 1 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.3, Details 15N and/or 13C labeled p53(1-39) with non-labeled TAZ2 complex in 50 mM MES, 200 mM NaCl, 0.1 mM ZnCl, 1mM DTT, pH 6.3.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TAZ2 | natural abundance | 1.1-1.2 mM | |
2 | TAD(1-39) | [U-100% 15N] | 1.0-1.1 mM | |
3 | MES | natural abundance | 50 mM | |
4 | NaCl | natural abundance | 200 mM | |
5 | ZnCl | natural abundance | 0.1 mM | |
6 | DTT | natural abundance | 1 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_15944_2k8f.nef |
Input source #2: Coordindates | 2k8f.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90 ATQSPGDSRRLSIQRAIQSLVHAAQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALAAYHAKHCQENKCPVPFCLNIKQK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ATQSPGDSRRLSIQRAIQSLVHAAQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALAAYHAKHCQENKCPVPFCLNIKQK
--------10--------20--------30--------- MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQA ||||||||||||||||||||||||||||||||||||||| MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQA
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 90 | 0 | 0 | 100.0 |
B | B | 39 | 0 | 0 | 100.0 |
Content subtype: combined_15944_2k8f.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90 ATQSPGDSRRLSIQRAIQSLVHAAQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALAAYHAKHCQENKCPVPFCLNIKQK ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .TQSPGDSRRLSIQRAIQSLVHAAQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALAAYHAKHCQENKCPVPFCLNIKQK
--------10--------20--------30--------- MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQA ||||||||||||||| |||||||||||||||||||||| .EEPQSDPSVEPPLSQ.TFSDLWKLLPENNVLSPLPSQA
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 391 | 356 | 91.0 |
1H chemical shifts | 557 | 464 | 83.3 |
15N chemical shifts | 105 | 83 | 79.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 180 | 169 | 93.9 |
1H chemical shifts | 179 | 174 | 97.2 |
15N chemical shifts | 85 | 83 | 97.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 211 | 187 | 88.6 |
1H chemical shifts | 378 | 290 | 76.7 |
15N chemical shifts | 20 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 43 | 38 | 88.4 |
1H chemical shifts | 43 | 37 | 86.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 17 | 0 | 0.0 |
1H chemical shifts | 17 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 177 | 150 | 84.7 |
1H chemical shifts | 242 | 185 | 76.4 |
15N chemical shifts | 38 | 28 | 73.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 78 | 71 | 91.0 |
1H chemical shifts | 71 | 63 | 88.7 |
15N chemical shifts | 32 | 28 | 87.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 99 | 79 | 79.8 |
1H chemical shifts | 171 | 122 | 71.3 |
15N chemical shifts | 6 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 19 | 14 | 73.7 |
1H chemical shifts | 19 | 14 | 73.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 10 | 0 | 0.0 |
1H chemical shifts | 11 | 0 | 0.0 |
15N chemical shifts | 1 | 0 | 0.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90 ATQSPGDSRRLSIQRAIQSLVHAAQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALAAYHAKHCQENKCPVPFCLNIKQK ||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||| ||||||||||| ..QSPGDSRRLSIQRAIQSLVHAAQCRNANCSLPSCQKMKRVVQHTK.CKRKTNGGCPICKQLIALAAYHAKHCQENK.PVPFCLNIKQK
--------10--------20--------30--------- MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQA | |||||||| | | ||||| ||||||| ...P..DPSVEPPL...T...L.KLLPE.NVLSPLP --------10--------20--------30------
--------10--------20--------30--------40--------50--------60--------70--------80--------90 ATQSPGDSRRLSIQRAIQSLVHAAQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALAAYHAKHCQENKCPVPFCLNIKQK ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .TQSPGDSRRLSIQRAIQSLVHAAQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALAAYHAKHCQENKCPVPFCLNIKQK
--------10--------20--------30--------- MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQA |||||||||| |||||||||||||||||||||||||| .EEPQSDPSVE..LSQETFSDLWKLLPENNVLSPLPSQA
--------10--------20--------30--------40--------50--------60--------70--------80--------90 ATQSPGDSRRLSIQRAIQSLVHAAQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALAAYHAKHCQENKCPVPFCLNIKQK |||||||||||||||||||| |||||||||||||| | | |||||||||||||||| |||||||| ....PGDSRRLSIQRAIQSLVHAA.........PSCQKMKRVVQHTK.C...T....PICKQLIALAAYHAKH........PFCLNIKQ --------10--------20--------30--------40--------50--------60--------70--------80---------
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90 ATQSPGDSRRLSIQRAIQSLVHAAQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALAAYHAKHCQENKCPVPFCLNIKQK ||||||||||||||||||||| ||||||||||||||||||||||||| |||||||||||||||||||| |||||||| ......DSRRLSIQRAIQSLVHAAQCR..NCSLPSCQKMKRVVQHTKGCKRKTN.GCPICKQLIALAAYHAKHCQ.......FCLNIKQK