Backbone and side chain 1H, 13C and 15N chemical shifts for the C-terminal domain of CdnL from Myxococcus xanthus
GSHMGSVGLR EIISEEDVKQ VYSILKEKDI SVDSTTWNRR YREYMEKIKT GSVFEIAEVL RDLYLLKGDK DLSFGERKML DTARSLLIKE LSLAKDCSED EIESDLKKIF NLA
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 96.5 % (1302 of 1349) | 98.4 % (695 of 706) | 93.7 % (493 of 526) | 97.4 % (114 of 117) |
Backbone | 97.9 % (664 of 678) | 97.8 % (227 of 232) | 98.2 % (327 of 333) | 97.3 % (110 of 113) |
Sidechain | 95.6 % (744 of 778) | 98.7 % (468 of 474) | 90.7 % (272 of 300) | 100.0 % (4 of 4) |
Aromatic | 71.8 % (56 of 78) | 97.4 % (38 of 39) | 44.7 % (17 of 38) | 100.0 % (1 of 1) |
Methyl | 100.0 % (132 of 132) | 100.0 % (66 of 66) | 100.0 % (66 of 66) |
1. CdnLC
GSHMGSVGLR EIISEEDVKQ VYSILKEKDI SVDSTTWNRR YREYMEKIKT GSVFEIAEVL RDLYLLKGDK DLSFGERKML DTARSLLIKE LSLAKDCSED EIESDLKKIF NLASolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CdnLC | [U-100% 13C; U-100% 15N] | 1-2 mM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 50 mM | |
4 | beta-mercaptoethanol | natural abundance | 2 mM | |
5 | sodium azide | natural abundance | 0.05 % | |
6 | DSS | natural abundance | 0.2 mM |
Solvent system 100% D2O, Pressure 1 atm, Temperature 308 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | CdnLC | [U-100% 13C; U-100% 15N] | 2 mM | |
8 | sodium chloride | natural abundance | 150 mM | |
9 | sodium phosphate | natural abundance | 50 mM | |
10 | beta-mercaptoethanol | natural abundance | 2 mM | |
11 | sodium azide | natural abundance | 0.05 % | |
12 | DSS | natural abundance | 0.2 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | CdnLC | natural abundance | 1.5 mM | |
14 | sodium chloride | natural abundance | 150 mM | |
15 | sodium phosphate | natural abundance | 50 mM | |
16 | beta-mercaptoethanol | natural abundance | 2 mM | |
17 | sodium azide | natural abundance | 0.05 % | |
18 | DSS | natural abundance | 0.2 mM |
Solvent system 100% D2O, Pressure 1 atm, Temperature 308 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
19 | CdnLC | natural abundance | 1.5 mM | |
20 | sodium chloride | natural abundance | 150 mM | |
21 | sodium phosphate | natural abundance | 50 mM | |
22 | beta-mercaptoethanol | natural abundance | 2 mM | |
23 | sodium azide | natural abundance | 0.05 % | |
24 | DSS | natural abundance | 0.2 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CdnLC | [U-100% 13C; U-100% 15N] | 1-2 mM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 50 mM | |
4 | beta-mercaptoethanol | natural abundance | 2 mM | |
5 | sodium azide | natural abundance | 0.05 % | |
6 | DSS | natural abundance | 0.2 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CdnLC | [U-100% 13C; U-100% 15N] | 1-2 mM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 50 mM | |
4 | beta-mercaptoethanol | natural abundance | 2 mM | |
5 | sodium azide | natural abundance | 0.05 % | |
6 | DSS | natural abundance | 0.2 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CdnLC | [U-100% 13C; U-100% 15N] | 1-2 mM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 50 mM | |
4 | beta-mercaptoethanol | natural abundance | 2 mM | |
5 | sodium azide | natural abundance | 0.05 % | |
6 | DSS | natural abundance | 0.2 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CdnLC | [U-100% 13C; U-100% 15N] | 1-2 mM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 50 mM | |
4 | beta-mercaptoethanol | natural abundance | 2 mM | |
5 | sodium azide | natural abundance | 0.05 % | |
6 | DSS | natural abundance | 0.2 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CdnLC | [U-100% 13C; U-100% 15N] | 1-2 mM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 50 mM | |
4 | beta-mercaptoethanol | natural abundance | 2 mM | |
5 | sodium azide | natural abundance | 0.05 % | |
6 | DSS | natural abundance | 0.2 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CdnLC | [U-100% 13C; U-100% 15N] | 1-2 mM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 50 mM | |
4 | beta-mercaptoethanol | natural abundance | 2 mM | |
5 | sodium azide | natural abundance | 0.05 % | |
6 | DSS | natural abundance | 0.2 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CdnLC | [U-100% 13C; U-100% 15N] | 1-2 mM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 50 mM | |
4 | beta-mercaptoethanol | natural abundance | 2 mM | |
5 | sodium azide | natural abundance | 0.05 % | |
6 | DSS | natural abundance | 0.2 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CdnLC | [U-100% 13C; U-100% 15N] | 1-2 mM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 50 mM | |
4 | beta-mercaptoethanol | natural abundance | 2 mM | |
5 | sodium azide | natural abundance | 0.05 % | |
6 | DSS | natural abundance | 0.2 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CdnLC | [U-100% 13C; U-100% 15N] | 1-2 mM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 50 mM | |
4 | beta-mercaptoethanol | natural abundance | 2 mM | |
5 | sodium azide | natural abundance | 0.05 % | |
6 | DSS | natural abundance | 0.2 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CdnLC | [U-100% 13C; U-100% 15N] | 1-2 mM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 50 mM | |
4 | beta-mercaptoethanol | natural abundance | 2 mM | |
5 | sodium azide | natural abundance | 0.05 % | |
6 | DSS | natural abundance | 0.2 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CdnLC | [U-100% 13C; U-100% 15N] | 1-2 mM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 50 mM | |
4 | beta-mercaptoethanol | natural abundance | 2 mM | |
5 | sodium azide | natural abundance | 0.05 % | |
6 | DSS | natural abundance | 0.2 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 308 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | CdnLC | [U-100% 13C; U-100% 15N] | 2 mM | |
8 | sodium chloride | natural abundance | 150 mM | |
9 | sodium phosphate | natural abundance | 50 mM | |
10 | beta-mercaptoethanol | natural abundance | 2 mM | |
11 | sodium azide | natural abundance | 0.05 % | |
12 | DSS | natural abundance | 0.2 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 308 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | CdnLC | [U-100% 13C; U-100% 15N] | 2 mM | |
8 | sodium chloride | natural abundance | 150 mM | |
9 | sodium phosphate | natural abundance | 50 mM | |
10 | beta-mercaptoethanol | natural abundance | 2 mM | |
11 | sodium azide | natural abundance | 0.05 % | |
12 | DSS | natural abundance | 0.2 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 308 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | CdnLC | [U-100% 13C; U-100% 15N] | 2 mM | |
8 | sodium chloride | natural abundance | 150 mM | |
9 | sodium phosphate | natural abundance | 50 mM | |
10 | beta-mercaptoethanol | natural abundance | 2 mM | |
11 | sodium azide | natural abundance | 0.05 % | |
12 | DSS | natural abundance | 0.2 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | CdnLC | natural abundance | 1.5 mM | |
14 | sodium chloride | natural abundance | 150 mM | |
15 | sodium phosphate | natural abundance | 50 mM | |
16 | beta-mercaptoethanol | natural abundance | 2 mM | |
17 | sodium azide | natural abundance | 0.05 % | |
18 | DSS | natural abundance | 0.2 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | CdnLC | natural abundance | 1.5 mM | |
14 | sodium chloride | natural abundance | 150 mM | |
15 | sodium phosphate | natural abundance | 50 mM | |
16 | beta-mercaptoethanol | natural abundance | 2 mM | |
17 | sodium azide | natural abundance | 0.05 % | |
18 | DSS | natural abundance | 0.2 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | CdnLC | natural abundance | 1.5 mM | |
14 | sodium chloride | natural abundance | 150 mM | |
15 | sodium phosphate | natural abundance | 50 mM | |
16 | beta-mercaptoethanol | natural abundance | 2 mM | |
17 | sodium azide | natural abundance | 0.05 % | |
18 | DSS | natural abundance | 0.2 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 308 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
19 | CdnLC | natural abundance | 1.5 mM | |
20 | sodium chloride | natural abundance | 150 mM | |
21 | sodium phosphate | natural abundance | 50 mM | |
22 | beta-mercaptoethanol | natural abundance | 2 mM | |
23 | sodium azide | natural abundance | 0.05 % | |
24 | DSS | natural abundance | 0.2 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 308 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
19 | CdnLC | natural abundance | 1.5 mM | |
20 | sodium chloride | natural abundance | 150 mM | |
21 | sodium phosphate | natural abundance | 50 mM | |
22 | beta-mercaptoethanol | natural abundance | 2 mM | |
23 | sodium azide | natural abundance | 0.05 % | |
24 | DSS | natural abundance | 0.2 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 308 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
19 | CdnLC | natural abundance | 1.5 mM | |
20 | sodium chloride | natural abundance | 150 mM | |
21 | sodium phosphate | natural abundance | 50 mM | |
22 | beta-mercaptoethanol | natural abundance | 2 mM | |
23 | sodium azide | natural abundance | 0.05 % | |
24 | DSS | natural abundance | 0.2 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 308 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
19 | CdnLC | natural abundance | 1.5 mM | |
20 | sodium chloride | natural abundance | 150 mM | |
21 | sodium phosphate | natural abundance | 50 mM | |
22 | beta-mercaptoethanol | natural abundance | 2 mM | |
23 | sodium azide | natural abundance | 0.05 % | |
24 | DSS | natural abundance | 0.2 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CdnLC | [U-100% 13C; U-100% 15N] | 1-2 mM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 50 mM | |
4 | beta-mercaptoethanol | natural abundance | 2 mM | |
5 | sodium azide | natural abundance | 0.05 % | |
6 | DSS | natural abundance | 0.2 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | CdnLC | natural abundance | 1.5 mM | |
14 | sodium chloride | natural abundance | 150 mM | |
15 | sodium phosphate | natural abundance | 50 mM | |
16 | beta-mercaptoethanol | natural abundance | 2 mM | |
17 | sodium azide | natural abundance | 0.05 % | |
18 | DSS | natural abundance | 0.2 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_15977_2lt3.nef |
Input source #2: Coordindates | 2lt3.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GSHMGSVGLREIISEEDVKQVYSILKEKDISVDSTTWNRRYREYMEKIKTGSVFEIAEVLRDLYLLKGDKDLSFGERKMLDTARSLLIKELSLAKDCSED |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSHMGSVGLREIISEEDVKQVYSILKEKDISVDSTTWNRRYREYMEKIKTGSVFEIAEVLRDLYLLKGDKDLSFGERKMLDTARSLLIKELSLAKDCSED -------110--- EIESDLKKIFNLA ||||||||||||| EIESDLKKIFNLA
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 113 | 0 | 0 | 100.0 |
Content subtype: combined_15977_2lt3.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GSHMGSVGLREIISEEDVKQVYSILKEKDISVDSTTWNRRYREYMEKIKTGSVFEIAEVLRDLYLLKGDKDLSFGERKMLDTARSLLIKELSLAKDCSED ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .SHMGSVGLREIISEEDVKQVYSILKEKDISVDSTTWNRRYREYMEKIKTGSVFEIAEVLRDLYLLKGDKDLSFGERKMLDTARSLLIKELSLAKDCSED -------110--- EIESDLKKIFNLA ||||||||||||| EIESDLKKIFNLA
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
10 | ARG | CZ | 159.7 |
20 | GLN | CD | 179.1 |
37 | TRP | CE2 | 139.2 |
40 | ARG | CZ | 159.7 |
61 | ARG | CZ | 160.1 |
84 | ARG | CZ | 160.0 |
92 | SER | HG | 5.15 |
111 | ASN | CG | 178.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 706 | 695 | 98.4 |
13C chemical shifts | 526 | 492 | 93.5 |
15N chemical shifts | 124 | 119 | 96.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 232 | 227 | 97.8 |
13C chemical shifts | 226 | 220 | 97.3 |
15N chemical shifts | 113 | 110 | 97.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 474 | 468 | 98.7 |
13C chemical shifts | 300 | 272 | 90.7 |
15N chemical shifts | 11 | 9 | 81.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 69 | 69 | 100.0 |
13C chemical shifts | 69 | 69 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 39 | 38 | 97.4 |
13C chemical shifts | 38 | 17 | 44.7 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GSHMGSVGLREIISEEDVKQVYSILKEKDISVDSTTWNRRYREYMEKIKTGSVFEIAEVLRDLYLLKGDKDLSFGERKMLDTARSLLIKELSLAKDCSED ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .....SVGLREIISEEDVKQVYSILKEKDISVDSTTWNRRYREYMEKIKTGSVFEIAEVLRDLYLLKGDKDLSFGERKMLDTARSLLIKELSLAKDCSED -------110--- EIESDLKKIFNLA ||||||||||||| EIESDLKKIFNLA
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GSHMGSVGLREIISEEDVKQVYSILKEKDISVDSTTWNRRYREYMEKIKTGSVFEIAEVLRDLYLLKGDKDLSFGERKMLDTARSLLIKELSLAKDCSED |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSHMGSVGLREIISEEDVKQVYSILKEKDISVDSTTWNRRYREYMEKIKTGSVFEIAEVLRDLYLLKGDKDLSFGERKMLDTARSLLIKELSLAKDCSED --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110--- EIESDLKKIFNLA |||||||||||| EIESDLKKIFNL -------110--