NMR structure of plasmid copy control protein ORF56 from sulfolobus islandicus
Polymer type: polypeptide(L)
Total | 1H | |
---|---|---|
All | 98.6 % (364 of 369) | 98.6 % (364 of 369) |
Backbone | 99.1 % (110 of 111) | 99.1 % (110 of 111) |
Sidechain | 98.4 % (254 of 258) | 98.4 % (254 of 258) |
Aromatic | 100.0 % (22 of 22) | 100.0 % (22 of 22) |
Methyl | 100.0 % (31 of 31) | 100.0 % (31 of 31) |
1. ORF56
GRPYKLLNGI KLGVYIPQEW HDRLMEIAKE KNLTLSDVCR LAIKEYLDNH DKQKKSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_2 | [U-13C; U-15N] | 1 mM | |
2 | entity_2 | natural abundance | 2 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_2 | [U-13C; U-15N] | 1 mM | |
2 | entity_2 | natural abundance | 2 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_2 | [U-13C; U-15N] | 1 mM | |
2 | entity_2 | natural abundance | 2 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_2 | [U-13C; U-15N] | 1 mM | |
2 | entity_2 | natural abundance | 2 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_2 | [U-13C; U-15N] | 1 mM | |
2 | entity_2 | natural abundance | 2 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_2 | [U-13C; U-15N] | 1 mM | |
2 | entity_2 | natural abundance | 2 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_2 | [U-13C; U-15N] | 1 mM | |
2 | entity_2 | natural abundance | 2 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_2 | [U-13C; U-15N] | 1 mM | |
2 | entity_2 | natural abundance | 2 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_2 | [U-13C; U-15N] | 1 mM | |
2 | entity_2 | natural abundance | 2 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_15987_2k9i.nef |
Input source #2: Coordindates | 2k9i.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-------10--------20--------30--------40--------50------ GRPYKLLNGIKLGVYIPQEWHDRLMEIAKEKNLTLSDVCRLAIKEYLDNHDKQKK ||||||||||||||||||||||||||||||||||||||||||||||||||||||| GRPYKLLNGIKLGVYIPQEWHDRLMEIAKEKNLTLSDVCRLAIKEYLDNHDKQKK --------10--------20--------30--------40--------50-----
-------10--------20--------30--------40--------50------ GRPYKLLNGIKLGVYIPQEWHDRLMEIAKEKNLTLSDVCRLAIKEYLDNHDKQKK ||||||||||||||||||||||||||||||||||||||||||||||||||||||| GRPYKLLNGIKLGVYIPQEWHDRLMEIAKEKNLTLSDVCRLAIKEYLDNHDKQKK --------10--------20--------30--------40--------50-----
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 55 | 0 | 0 | 100.0 |
B | B | 55 | 0 | 0 | 100.0 |
Content subtype: combined_15987_2k9i.nef
Assigned chemical shifts
-------10--------20--------30--------40--------50------ GRPYKLLNGIKLGVYIPQEWHDRLMEIAKEKNLTLSDVCRLAIKEYLDNHDKQKK ||||||||||||||||||||||||||||||||||||||||||||||||||||||| GRPYKLLNGIKLGVYIPQEWHDRLMEIAKEKNLTLSDVCRLAIKEYLDNHDKQKK
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
30 | LYS | HZ1 | 8.006 |
30 | LYS | HZ2 | 8.006 |
30 | LYS | HZ3 | 8.006 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 369 | 360 | 97.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 111 | 110 | 99.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 258 | 250 | 96.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 32 | 32 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 22 | 22 | 100.0 |
Distance restraints
-------10--------20--------30--------40--------50------ GRPYKLLNGIKLGVYIPQEWHDRLMEIAKEKNLTLSDVCRLAIKEYLDNHDKQKK | | | |||||||||||||||| | ||||||||||||||| .........I.L.V.IPQEWHDRLMEIAKEK.L.LSDVCRLAIKEYLDN -------10--------20--------30--------40--------50
-------10--------20--------30--------40--------50------ GRPYKLLNGIKLGVYIPQEWHDRLMEIAKEKNLTLSDVCRLAIKEYLDNHDKQKK | | | |||||||||||||||| | ||||||||||||||| .........I.L.V.IPQEWHDRLMEIAKEK.L.LSDVCRLAIKEYLDN -------10--------20--------30--------40--------50
Dihedral angle restraints
-------10--------20--------30--------40--------50------ GRPYKLLNGIKLGVYIPQEWHDRLMEIAKEKNLTLSDVCRLAIKEYLDNHDKQKK |||||||||||||||||||||||||||||||||||||||||||| .......NGIKLGVYIPQEWHDRLMEIAKEKNLTLSDVCRLAIKEYLDNHD -------10--------20--------30--------40--------50--
-------10--------20--------30--------40--------50------ GRPYKLLNGIKLGVYIPQEWHDRLMEIAKEKNLTLSDVCRLAIKEYLDNHDKQKK |||||||||||||||||||||||||||||||||||||||||||| .......NGIKLGVYIPQEWHDRLMEIAKEKNLTLSDVCRLAIKEYLDNHD -------10--------20--------30--------40--------50--