TonB2 PROTEIN FROM Vibrio anguillarum
AHPFTSAPTF GDFGSNQQAM PLYRVEPVYP SRALKRGVEG FVTLSFTIDT TGKAVDINVV DANPKRMFER EAMQALKKWK YQPQIVDGKA IEQPGQTVTV EFKIAK
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 74.5 % (937 of 1258) | 82.0 % (539 of 657) | 60.4 % (297 of 492) | 92.7 % (101 of 109) |
Backbone | 80.8 % (501 of 620) | 94.3 % (199 of 211) | 66.9 % (208 of 311) | 95.9 % (94 of 98) |
Sidechain | 72.0 % (531 of 737) | 76.2 % (340 of 446) | 65.7 % (184 of 280) | 63.6 % (7 of 11) |
Aromatic | 26.4 % (29 of 110) | 50.9 % (28 of 55) | 0.0 % (0 of 54) | 100.0 % (1 of 1) |
Methyl | 90.2 % (101 of 112) | 91.1 % (51 of 56) | 89.3 % (50 of 56) |
1. TonB2-CTD
AHPFTSAPTF GDFGSNQQAM PLYRVEPVYP SRALKRGVEG FVTLSFTIDT TGKAVDINVV DANPKRMFER EAMQALKKWK YQPQIVDGKA IEQPGQTVTV EFKIAKSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TonB2-CTD | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | D2O | natural abundance | 90 % | |
3 | DSS | natural abundance | 1 mM | |
4 | H2O | natural abundance | 10 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TonB2-CTD | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | D2O | natural abundance | 90 % | |
3 | DSS | natural abundance | 1 mM | |
4 | H2O | natural abundance | 10 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TonB2-CTD | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | D2O | natural abundance | 90 % | |
3 | DSS | natural abundance | 1 mM | |
4 | H2O | natural abundance | 10 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TonB2-CTD | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | D2O | natural abundance | 90 % | |
3 | DSS | natural abundance | 1 mM | |
4 | H2O | natural abundance | 10 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TonB2-CTD | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | D2O | natural abundance | 90 % | |
3 | DSS | natural abundance | 1 mM | |
4 | H2O | natural abundance | 10 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TonB2-CTD | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | D2O | natural abundance | 90 % | |
3 | DSS | natural abundance | 1 mM | |
4 | H2O | natural abundance | 10 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TonB2-CTD | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | D2O | natural abundance | 90 % | |
3 | DSS | natural abundance | 1 mM | |
4 | H2O | natural abundance | 10 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TonB2-CTD | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | D2O | natural abundance | 90 % | |
3 | DSS | natural abundance | 1 mM | |
4 | H2O | natural abundance | 10 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TonB2-CTD | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | D2O | natural abundance | 90 % | |
3 | DSS | natural abundance | 1 mM | |
4 | H2O | natural abundance | 10 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TonB2-CTD | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | D2O | natural abundance | 90 % | |
3 | DSS | natural abundance | 1 mM | |
4 | H2O | natural abundance | 10 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TonB2-CTD | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | D2O | natural abundance | 90 % | |
3 | DSS | natural abundance | 1 mM | |
4 | H2O | natural abundance | 10 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TonB2-CTD | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | D2O | natural abundance | 90 % | |
3 | DSS | natural abundance | 1 mM | |
4 | H2O | natural abundance | 10 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TonB2-CTD | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | D2O | natural abundance | 90 % | |
3 | DSS | natural abundance | 1 mM | |
4 | H2O | natural abundance | 10 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_15988_2k9k.nef |
Input source #2: Coordindates | 2k9k.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200 DHPFTSAPTFGDFGSNQQAMPLYRVEPVYPSRALKRGVEGFVTLSFTIDTTGKAVDINVVDANPKRMFEREAMQALKKWKYQPQIVDGKAIEQPGQTVTV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| DHPFTSAPTFGDFGSNQQAMPLYRVEPVYPSRALKRGVEGFVTLSFTIDTTGKAVDINVVDANPKRMFEREAMQALKKWKYQPQIVDGKAIEQPGQTVTV --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ------ EFKIAK |||||| EFKIAK ------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 106 | 0 | 0 | 100.0 |
Content subtype: combined_15988_2k9k.nef
Assigned chemical shifts
-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200 DHPFTSAPTFGDFGSNQQAMPLYRVEPVYPSRALKRGVEGFVTLSFTIDTTGKAVDINVVDANPKRMFEREAMQALKKWKYQPQIVDGKAIEQPGQTVTV |||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...FTSA.TFGDFGSNQQAMPLYRVEPVYPSRALKRGVEGFVTLSFTIDTTGKAVDINVVDANPKRMFEREAMQALKKWKYQPQIVDGKAIEQPGQTVTV ------ EFKIAK |||||| EFKIAK
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 658 | 532 | 80.9 |
13C chemical shifts | 492 | 279 | 56.7 |
15N chemical shifts | 114 | 100 | 87.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 211 | 198 | 93.8 |
13C chemical shifts | 212 | 102 | 48.1 |
15N chemical shifts | 98 | 93 | 94.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 447 | 334 | 74.7 |
13C chemical shifts | 280 | 177 | 63.2 |
15N chemical shifts | 16 | 7 | 43.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 58 | 52 | 89.7 |
13C chemical shifts | 58 | 49 | 84.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 55 | 28 | 50.9 |
13C chemical shifts | 54 | 0 | 0.0 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200 DHPFTSAPTFGDFGSNQQAMPLYRVEPVYPSRALKRGVEGFVTLSFTIDTTGKAVDINVVDANPKRMFEREAMQALKKWKYQPQIVDGKAIEQPGQTVTV ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...............NQQAMPLYRVEPVYPSRALKRGVEGFVTLSFTIDTTGKAVDINVVDANPKRMFEREAMQALKKWKYQPQIVDGKAIEQPGQTVTV ------ EFKIAK |||||| EFKIAK
Dihedral angle restraints
-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200 DHPFTSAPTFGDFGSNQQAMPLYRVEPVYPSRALKRGVEGFVTLSFTIDTTGKAVDINVVDANPKRMFEREAMQALKKWKYQPQIVDGKAIEQPGQTVTV ||| |||| ||| ||| |||||||||||||||||||||||||||||||||| ||||||||||||||||||||| ||||| ||||| .............GSN.QAMP.YRV.PVY.SRALKRGVEGFVTLSFTIDTTGKAVDINVVDANP...FEREAMQALKKWKYQPQIVDG.AIEQP.QTVTV -------110-------120-------130-------140-------150-------160-------170-------180-------190-------200 ------ EFKIAK ||||| EFKIA -----