BMRBj - BMREntryMaster

Found 1 Document (4.482 seconds)

BMRB: 16002

2K9U

cytoskeletal complex

Authors

Ithychanda, S.N.

Assembly

Migfilin

Entity

1. Migfilin, entity 1 (polymer, Thiol state: all free), 119 monomers, 12422.62 Da Detail

GIPEFFQFTV GPLGEGGAHK VRAGGTGLER GVAGVPAEFS IWTREAGAGG LSIAVEGPSK AEIAFEDRKD GSCGVSYVVQ EPGDYEVSIK FNDEHIPDSP FVVPVASLSD DARRLTVTS

2. Migfilin, entity 2 (polymer, Thiol state: not present), 24 monomers, 2656.109 Da Detail

MASKPEKRVA SSVFITLAPP RRDV

Total weight

15078.729 Da

Max. entity weight

12422.62 Da

Source organism

Homo sapiens

Exptl. method

solution NMR

Refine. method

simulated annealing

Data set

assigned_chemical_shifts

Chem. Shift Complete

Sequence coverage: 92.3 %, Completeness: 68.9 %, Completeness (bb): 72.7 % Detail

Polymer type: polypeptide(L)

	Total	¹H	¹³C	¹⁵N
All	68.9 % (1076 of 1561)	76.5 % (616 of 805)	56.1 % (348 of 620)	82.4 % (112 of 136)
Backbone	72.7 % (608 of 836)	87.7 % (256 of 292)	58.3 % (240 of 412)	84.8 % (112 of 132)
Sidechain	66.7 % (568 of 851)	70.0 % (359 of 513)	62.6 % (209 of 334)	0.0 % (0 of 4)
Aromatic	1.7 % (2 of 116)	3.4 % (2 of 58)	0.0 % (0 of 57)	0.0 % (0 of 1)
Methyl	80.1 % (125 of 156)	87.2 % (68 of 78)	73.1 % (57 of 78)

1. entity 1

GIPEFFQFTV GPLGEGGAHK VRAGGTGLER GVAGVPAEFS IWTREAGAGG LSIAVEGPSK AEIAFEDRKD GSCGVSYVVQ EPGDYEVSIK FNDEHIPDSP FVVPVASLSD DARRLTVTS

2. entity 2

MASKPEKRVA SSVFITLAPP RRDV

Show sample condition

Sample

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 302 K, pH 6.4

#	Name	Isotope labeling	Type	Concentration
1	entity_1	[U-100% 13C; U-100% 15N]		0.1-1 mM
2	entity_2	natural abundance		0.1-1 mM

Protein Blocks Logo

Calculated from 20 models in PDB: 2K9U, Strand ID: A, B Detail

Release date

2009-04-03

Citation

Migfilin, a molecular switch in regulation of integrin activation
Ithychanda, S., Das, M., Ma, Y., Ding, K., Wang, X., Gupta, S., Wu, C., Plow, E.F., Qin, J.
J. Biol. Chem. (2009), 284, 4713-4722, PubMed 19074766 , DOI 10.1074/jbc.M807719200 , Abstract

Related entities 1. Migfilin, entity 1, : 3 : 221 entities Detail

Related entities 2. Migfilin, entity 2, : 1 : 4 : 4 : 3 entities Detail

Interaction partners 1. Migfilin, entity 1, : 15 interactors Detail

More details for 15 interactors identified by 6 citations

Interaction partners 2. Migfilin, entity 2, : 5 interactors Detail

More details for 5 interactors identified by 2 citations

Experiments performed 1 experiments Detail

NMR combined restraints 5 contents Detail

Properties

Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints	combined_16002_2k9u.nef
Input source #2: Coordindates	2k9u.cif
Diamagnetism of the molecular assembly	True (excluding Oxygen atoms)
Whether the assembly has a disulfide bond	None
Whether the assembly has a other bond	None
Whether the assembly contains a cyclic polymer	None
Overall data processing status	Warning

Disulfide bonds

None

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

None

Non-standard residues

None

Sequence alignments

Entity_assembly_ID (NMR): A vs Auth_asym_ID (model): A

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100
GIPEFFQFTVGPLGEGGAHKVRAGGTGLERGVAGVPAEFSIWTREAGAGGLSIAVEGPSKAEIAFEDRKDGSCGVSYVVQEPGDYEVSIKFNDEHIPDSP
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
GIPEFFQFTVGPLGEGGAHKVRAGGTGLERGVAGVPAEFSIWTREAGAGGLSIAVEGPSKAEIAFEDRKDGSCGVSYVVQEPGDYEVSIKFNDEHIPDSP

-------110---------
FVVPVASLSDDARRLTVTS
|||||||||||||||||||
FVVPVASLSDDARRLTVTS

Entity_assembly_ID (NMR): B vs Auth_asym_ID (model): B

--------10--------20----
MASKPEKRVASSVFITLAPPRRDV
||||||||||||||||||||||||
MASKPEKRVASSVFITLAPPRRDV

Chain assignments

Entity_assembly_ID (NMR)	Auth_asym_ID (model)	Length	Unmapped	Conflict	Sequence coverage (%)
A	A	119	0	0	100.0
B	B	24	0	0	100.0

Content subtype: combined_16002_2k9u.nef

#	Content subtype	Saveframe	Status	# of rows (sets)	Experiment type	Sequence coverage (%)
1	Assigned chemical shifts	assigned_chem_shift_list_1	Warning	1039		100.0 (chain: A, length: 119), 54.2 (chain: B, length: 24)
1	Distance restraints	CNS/XPLOR_distance_constraints_2	Warning	1911 (1)	noe	98.3 (chain: A, length: 119), 58.3 (chain: B, length: 24)
2	Distance restraints	CNS/XPLOR_distance_constraints_3	Warning	92 (1)	hbond	42.0 (chain: A, length: 119), 20.8 (chain: B, length: 24)
1	Dihedral angle restraints	CNS/XPLOR_dihedral_4	OK	80 (80)	.	58.8 (chain: A, length: 119)

Assigned chemical shifts

Saveframe: assigned_chem_shift_list_1
- Status: Warning
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 119, Sequence coverage: 100.0%
  - Entity_assembly_ID: B, Chain length: 24, Sequence coverage: 54.2%
- Total number of assignments
  - ¹H chemical shifts: 610
  - ¹³C chemical shifts: 321
  - ¹⁵N chemical shifts: 108
- Completeness of assignments
  - Entity_assemble_ID: A
  - Entity_assemble_ID: B
- Redox state of CYS
- Peptide bond of PRO
- Rotameric state of ILE , LEU, and VAL
- Histogram of normalized assigned chemical shifts
- Random coil index and derived parameters (S² and NMR RMSD)
  - Chain_ID: A
  - Chain_ID: B

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	657	552	84.0
¹³C chemical shifts	509	321	63.1
¹⁵N chemical shifts	121	108	89.3

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	247	235	95.1
¹³C chemical shifts	238	115	48.3
¹⁵N chemical shifts	111	108	97.3

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	410	317	77.3
¹³C chemical shifts	271	206	76.0
¹⁵N chemical shifts	10	0	0.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	64	58	90.6
¹³C chemical shifts	64	57	89.1

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	53	0	0.0
¹³C chemical shifts	52	0	0.0
¹⁵N chemical shifts	1	0	0.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	148	58	39.2
¹³C chemical shifts	111	0	0.0
¹⁵N chemical shifts	24	0	0.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	45	17	37.8
¹³C chemical shifts	48	0	0.0
¹⁵N chemical shifts	21	0	0.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	103	41	39.8
¹³C chemical shifts	63	0	0.0
¹⁵N chemical shifts	3	0	0.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	15	11	73.3
¹³C chemical shifts	15	0	0.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	5	2	40.0
¹³C chemical shifts	5	0	0.0

Distance restraints

Saveframe: CNS/XPLOR_distance_constraints_2
- Status: Warning
- Experiment type: noe
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 119, Sequence coverage: 98.3%
  - Entity_assembly_ID: B, Chain length: 24, Sequence coverage: 58.3%
- Total number of restraints: 1911
- Weight of restraints: 1.0 (1911)
- Potential type of restraints: square-well-parabolic (1911)
- Range of distance target values: 2.25, 4.65 (Å)
- Histogram of distance target values
- Histogram of discrepancy in distance target values
- Distance restraints per residue
  - Chain_ID: A
  - Chain_ID: B
- Distance restraints on contact map
- Saveframe: CNS/XPLOR_distance_constraints_3
  - Status: Warning
  - Experiment type: hbond
  - Sequence coverage of experimental data
    - Entity_assembly_ID: A, Chain length: 119, Sequence coverage: 42.0%
    - Entity_assembly_ID: B, Chain length: 24, Sequence coverage: 20.8%
  - Total number of restraints: 92
  - Weight of restraints: 1.0 (92)
  - Potential type of restraints: square-well-parabolic (92)
  - Range of distance target values: 2.0, 2.95 (Å)
  - Histogram of distance target values
  - Distance restraints per residue
    - Chain_ID: A
    - Chain_ID: B
  - Distance restraints on contact map

Dihedral angle restraints

Saveframe: CNS/XPLOR_dihedral_4
- Status: OK
- Experiment type: .
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 119, Sequence coverage: 58.8%
- Total number of restraints: 80
- Total number of restraints per polymer type: 80
- Weight of restraints: 1.0 (80)
- Potential type of restraints: square-well-parabolic (80)
- Plot of Phi-Psi angle restraints
- Dihedral angle restraints per residue
  - Chain_ID: A

Keywords cytoskeletal complex

Search

Query history

Resources

Search for primary databases

Search for subsidiary databases

Display

Hits per page

Statistics

Query Changes will take effect after "OK" button is selected.

Maximum hits

Default conjunction operator

Omni-box

Search filter

Sequence search (BLAST)

E-value

Query sequence coverage

Miscellaneous

The number of previewed publications

Completeness of assigned chemical shift

Sequence chart about top aligned regions

Sequence chart about interacting regions

Hit context with highlight

Link destinations for BMRB, PDB and EMDB

Found 1 Document (4.482 seconds)

BMRB: 16002

Sample

Related entities 1. Migfilin, entity 1, : 3 : 221 entities Detail

Related entities 2. Migfilin, entity 2, : 1 : 4 : 4 : 3 entities Detail

Interaction partners 1. Migfilin, entity 1, : 15 interactors Detail

Interaction partners 2. Migfilin, entity 2, : 5 interactors Detail

Experiments performed 1 experiments Detail

Instrument

Sample

NMR combined restraints 5 contents Detail