NMR structure of the protein TM1112
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 95.8 % (1088 of 1136) | 97.5 % (583 of 598) | 92.9 % (416 of 448) | 98.9 % (89 of 90) |
Backbone | 97.3 % (510 of 524) | 98.3 % (174 of 177) | 96.2 % (253 of 263) | 98.8 % (83 of 84) |
Sidechain | 95.0 % (662 of 697) | 97.1 % (409 of 421) | 91.5 % (247 of 270) | 100.0 % (6 of 6) |
Aromatic | 81.1 % (99 of 122) | 91.8 % (56 of 61) | 68.4 % (39 of 57) | 100.0 % (4 of 4) |
Methyl | 98.9 % (91 of 92) | 100.0 % (46 of 46) | 97.8 % (45 of 46) |
1. TM1112
MEVKIEKPTP EKLKELSVEK WPIWEKEVSE FDWYYDTNET CYILEGKVEV TTEDGKKYVI EKGDLVTFPK GLRCRWKVLE PVRKHYNLFSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TM1112 | [U-98% 13C; U-98% 15N] | 1.3 mM | |
2 | D10-DTT | natural abundance | 4.5 mM | |
3 | DTT | natural abundance | 0.5 mM | |
4 | potassium phosphate | natural abundance | 25 mM | |
5 | sodium chloride | natural abundance | 50 mM | |
6 | sodium azide | natural abundance | 0.03 % | |
7 | D2O | natural abundance | 10 % | |
8 | H2O | natural abundance | 90 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TM1112 | [U-98% 13C; U-98% 15N] | 1.3 mM | |
2 | D10-DTT | natural abundance | 4.5 mM | |
3 | DTT | natural abundance | 0.5 mM | |
4 | potassium phosphate | natural abundance | 25 mM | |
5 | sodium chloride | natural abundance | 50 mM | |
6 | sodium azide | natural abundance | 0.03 % | |
7 | D2O | natural abundance | 10 % | |
8 | H2O | natural abundance | 90 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TM1112 | [U-98% 13C; U-98% 15N] | 1.3 mM | |
2 | D10-DTT | natural abundance | 4.5 mM | |
3 | DTT | natural abundance | 0.5 mM | |
4 | potassium phosphate | natural abundance | 25 mM | |
5 | sodium chloride | natural abundance | 50 mM | |
6 | sodium azide | natural abundance | 0.03 % | |
7 | D2O | natural abundance | 10 % | |
8 | H2O | natural abundance | 90 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TM1112 | [U-98% 13C; U-98% 15N] | 1.3 mM | |
2 | D10-DTT | natural abundance | 4.5 mM | |
3 | DTT | natural abundance | 0.5 mM | |
4 | potassium phosphate | natural abundance | 25 mM | |
5 | sodium chloride | natural abundance | 50 mM | |
6 | sodium azide | natural abundance | 0.03 % | |
7 | D2O | natural abundance | 10 % | |
8 | H2O | natural abundance | 90 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TM1112 | [U-98% 13C; U-98% 15N] | 1.3 mM | |
2 | D10-DTT | natural abundance | 4.5 mM | |
3 | DTT | natural abundance | 0.5 mM | |
4 | potassium phosphate | natural abundance | 25 mM | |
5 | sodium chloride | natural abundance | 50 mM | |
6 | sodium azide | natural abundance | 0.03 % | |
7 | D2O | natural abundance | 10 % | |
8 | H2O | natural abundance | 90 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TM1112 | [U-98% 13C; U-98% 15N] | 1.3 mM | |
2 | D10-DTT | natural abundance | 4.5 mM | |
3 | DTT | natural abundance | 0.5 mM | |
4 | potassium phosphate | natural abundance | 25 mM | |
5 | sodium chloride | natural abundance | 50 mM | |
6 | sodium azide | natural abundance | 0.03 % | |
7 | D2O | natural abundance | 10 % | |
8 | H2O | natural abundance | 90 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TM1112 | [U-98% 13C; U-98% 15N] | 1.3 mM | |
2 | D10-DTT | natural abundance | 4.5 mM | |
3 | DTT | natural abundance | 0.5 mM | |
4 | potassium phosphate | natural abundance | 25 mM | |
5 | sodium chloride | natural abundance | 50 mM | |
6 | sodium azide | natural abundance | 0.03 % | |
7 | D2O | natural abundance | 10 % | |
8 | H2O | natural abundance | 90 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TM1112 | [U-98% 13C; U-98% 15N] | 1.3 mM | |
2 | D10-DTT | natural abundance | 4.5 mM | |
3 | DTT | natural abundance | 0.5 mM | |
4 | potassium phosphate | natural abundance | 25 mM | |
5 | sodium chloride | natural abundance | 50 mM | |
6 | sodium azide | natural abundance | 0.03 % | |
7 | D2O | natural abundance | 10 % | |
8 | H2O | natural abundance | 90 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TM1112 | [U-98% 13C; U-98% 15N] | 1.3 mM | |
2 | D10-DTT | natural abundance | 4.5 mM | |
3 | DTT | natural abundance | 0.5 mM | |
4 | potassium phosphate | natural abundance | 25 mM | |
5 | sodium chloride | natural abundance | 50 mM | |
6 | sodium azide | natural abundance | 0.03 % | |
7 | D2O | natural abundance | 10 % | |
8 | H2O | natural abundance | 90 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_16006_2k9z.nef |
Input source #2: Coordindates | 2k9z.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------- MEVKIEKPTPEKLKELSVEKWPIWEKEVSEFDWYYDTNETCYILEGKVEVTTEDGKKYVIEKGDLVTFPKGLRCRWKVLEPVRKHYNLF ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MEVKIEKPTPEKLKELSVEKWPIWEKEVSEFDWYYDTNETCYILEGKVEVTTEDGKKYVIEKGDLVTFPKGLRCRWKVLEPVRKHYNLF
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 89 | 0 | 0 | 100.0 |
Content subtype: combined_16006_2k9z.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------- MEVKIEKPTPEKLKELSVEKWPIWEKEVSEFDWYYDTNETCYILEGKVEVTTEDGKKYVIEKGDLVTFPKGLRCRWKVLEPVRKHYNLF ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MEVKIEKPTPEKLKELSVEKWPIWEKEVSEFDWYYDTNETCYILEGKVEVTTEDGKKYVIEKGDLVTFPKGLRCRWKVLEPVRKHYNLF
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 598 | 582 | 97.3 |
13C chemical shifts | 448 | 414 | 92.4 |
15N chemical shifts | 93 | 91 | 97.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 177 | 173 | 97.7 |
13C chemical shifts | 178 | 169 | 94.9 |
15N chemical shifts | 84 | 82 | 97.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 421 | 409 | 97.1 |
13C chemical shifts | 270 | 245 | 90.7 |
15N chemical shifts | 9 | 9 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 47 | 47 | 100.0 |
13C chemical shifts | 47 | 46 | 97.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 61 | 56 | 91.8 |
13C chemical shifts | 57 | 37 | 64.9 |
15N chemical shifts | 4 | 4 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------- MEVKIEKPTPEKLKELSVEKWPIWEKEVSEFDWYYDTNETCYILEGKVEVTTEDGKKYVIEKGDLVTFPKGLRCRWKVLEPVRKHYNLF |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .EVKIEKPTPEKLKELSVEKWPIWEKEVSEFDWYYDTNETCYILEGKVEVTTEDGKKYVIEKGDLVTFPKGLRCRWKVLEPVRKHYNLF