NMR structure of the protein TM1367
MRVELLFESG KCVIDLNEEY EVVKLLKEKI PFESVVNTWG EEIYFSTPVN VQKMENPREV VEIGDVGYWP PGKALCLFFG KTPMSDDKIQ PASAVNVIGK IVEGLEDLKK IKDGEKVAVR FASS
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 96.2 % (1426 of 1483) | 97.8 % (757 of 774) | 93.7 % (546 of 583) | 97.6 % (123 of 126) |
Backbone | 96.8 % (707 of 730) | 98.0 % (245 of 250) | 95.9 % (348 of 363) | 97.4 % (114 of 117) |
Sidechain | 96.0 % (833 of 868) | 97.7 % (512 of 524) | 93.1 % (312 of 335) | 100.0 % (9 of 9) |
Aromatic | 70.4 % (76 of 108) | 81.5 % (44 of 54) | 57.7 % (30 of 52) | 100.0 % (2 of 2) |
Methyl | 100.0 % (148 of 148) | 100.0 % (74 of 74) | 100.0 % (74 of 74) |
1. TM1367
MRVELLFESG KCVIDLNEEY EVVKLLKEKI PFESVVNTWG EEIYFSTPVN VQKMENPREV VEIGDVGYWP PGKALCLFFG KTPMSDDKIQ PASAVNVIGK IVEGLEDLKK IKDGEKVAVR FASSSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DTT | natural abundance | 0.5 mM | |
2 | D10-DTT | natural abundance | 4.5 mM | |
3 | sodium azide | natural abundance | 0.03 % | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | sodium phosphate | natural abundance | 25 mM | |
6 | D2O | natural abundance | 10 % | |
7 | H2O | natural abundance | 90 % | |
8 | TM1367 | [U-98% 13C; U-98% 15N] | 1.5 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DTT | natural abundance | 0.5 mM | |
2 | D10-DTT | natural abundance | 4.5 mM | |
3 | sodium azide | natural abundance | 0.03 % | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | sodium phosphate | natural abundance | 25 mM | |
6 | D2O | natural abundance | 10 % | |
7 | H2O | natural abundance | 90 % | |
8 | TM1367 | [U-98% 13C; U-98% 15N] | 1.5 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DTT | natural abundance | 0.5 mM | |
2 | D10-DTT | natural abundance | 4.5 mM | |
3 | sodium azide | natural abundance | 0.03 % | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | sodium phosphate | natural abundance | 25 mM | |
6 | D2O | natural abundance | 10 % | |
7 | H2O | natural abundance | 90 % | |
8 | TM1367 | [U-98% 13C; U-98% 15N] | 1.5 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DTT | natural abundance | 0.5 mM | |
2 | D10-DTT | natural abundance | 4.5 mM | |
3 | sodium azide | natural abundance | 0.03 % | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | sodium phosphate | natural abundance | 25 mM | |
6 | D2O | natural abundance | 10 % | |
7 | H2O | natural abundance | 90 % | |
8 | TM1367 | [U-98% 13C; U-98% 15N] | 1.5 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DTT | natural abundance | 0.5 mM | |
2 | D10-DTT | natural abundance | 4.5 mM | |
3 | sodium azide | natural abundance | 0.03 % | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | sodium phosphate | natural abundance | 25 mM | |
6 | D2O | natural abundance | 10 % | |
7 | H2O | natural abundance | 90 % | |
8 | TM1367 | [U-98% 13C; U-98% 15N] | 1.5 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DTT | natural abundance | 0.5 mM | |
2 | D10-DTT | natural abundance | 4.5 mM | |
3 | sodium azide | natural abundance | 0.03 % | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | sodium phosphate | natural abundance | 25 mM | |
6 | D2O | natural abundance | 10 % | |
7 | H2O | natural abundance | 90 % | |
8 | TM1367 | [U-98% 13C; U-98% 15N] | 1.5 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DTT | natural abundance | 0.5 mM | |
2 | D10-DTT | natural abundance | 4.5 mM | |
3 | sodium azide | natural abundance | 0.03 % | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | sodium phosphate | natural abundance | 25 mM | |
6 | D2O | natural abundance | 10 % | |
7 | H2O | natural abundance | 90 % | |
8 | TM1367 | [U-98% 13C; U-98% 15N] | 1.5 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DTT | natural abundance | 0.5 mM | |
2 | D10-DTT | natural abundance | 4.5 mM | |
3 | sodium azide | natural abundance | 0.03 % | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | sodium phosphate | natural abundance | 25 mM | |
6 | D2O | natural abundance | 10 % | |
7 | H2O | natural abundance | 90 % | |
8 | TM1367 | [U-98% 13C; U-98% 15N] | 1.5 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DTT | natural abundance | 0.5 mM | |
2 | D10-DTT | natural abundance | 4.5 mM | |
3 | sodium azide | natural abundance | 0.03 % | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | sodium phosphate | natural abundance | 25 mM | |
6 | D2O | natural abundance | 10 % | |
7 | H2O | natural abundance | 90 % | |
8 | TM1367 | [U-98% 13C; U-98% 15N] | 1.5 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_16007_2ka0.nef |
Input source #2: Coordindates | 2ka0.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MRVELLFESGKCVIDLNEEYEVVKLLKEKIPFESVVNTWGEEIYFSTPVNVQKMENPREVVEIGDVGYWPPGKALCLFFGKTPMSDDKIQPASAVNVIGK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MRVELLFESGKCVIDLNEEYEVVKLLKEKIPFESVVNTWGEEIYFSTPVNVQKMENPREVVEIGDVGYWPPGKALCLFFGKTPMSDDKIQPASAVNVIGK -------110-------120---- IVEGLEDLKKIKDGEKVAVRFASS |||||||||||||||||||||||| IVEGLEDLKKIKDGEKVAVRFASS
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 124 | 0 | 0 | 100.0 |
Content subtype: combined_16007_2ka0.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MRVELLFESGKCVIDLNEEYEVVKLLKEKIPFESVVNTWGEEIYFSTPVNVQKMENPREVVEIGDVGYWPPGKALCLFFGKTPMSDDKIQPASAVNVIGK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MRVELLFESGKCVIDLNEEYEVVKLLKEKIPFESVVNTWGEEIYFSTPVNVQKMENPREVVEIGDVGYWPPGKALCLFFGKTPMSDDKIQPASAVNVIGK -------110-------120---- IVEGLEDLKKIKDGEKVAVRFASS |||||||||||||||||||||||| IVEGLEDLKKIKDGEKVAVRFASS
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 774 | 766 | 99.0 |
13C chemical shifts | 583 | 550 | 94.3 |
15N chemical shifts | 129 | 126 | 97.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 250 | 247 | 98.8 |
13C chemical shifts | 248 | 235 | 94.8 |
15N chemical shifts | 117 | 114 | 97.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 524 | 519 | 99.0 |
13C chemical shifts | 335 | 315 | 94.0 |
15N chemical shifts | 12 | 12 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 77 | 77 | 100.0 |
13C chemical shifts | 77 | 77 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 54 | 49 | 90.7 |
13C chemical shifts | 52 | 32 | 61.5 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MRVELLFESGKCVIDLNEEYEVVKLLKEKIPFESVVNTWGEEIYFSTPVNVQKMENPREVVEIGDVGYWPPGKALCLFFGKTPMSDDKIQPASAVNVIGK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MRVELLFESGKCVIDLNEEYEVVKLLKEKIPFESVVNTWGEEIYFSTPVNVQKMENPREVVEIGDVGYWPPGKALCLFFGKTPMSDDKIQPASAVNVIGK -------110-------120---- IVEGLEDLKKIKDGEKVAVRFASS |||||||||||||||||||||||| IVEGLEDLKKIKDGEKVAVRFASS