Solution NMR structure of SSP0047 from Staphylococcus saprophyticus. Northeast Structural Genomics Consortium Target SyR6.
MTLELQLKHY ITNLFNLPRD EKWECESIEE VADDILPDQY VRLGPLSNKI LQTNTYYSDT LHKSNIYPFI LYYQKQLIAI GFIDENHDMD FLYLHNTVMP LLDQRYLLTG GQLEHHHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 91.3 % (1357 of 1486) | 91.0 % (701 of 770) | 91.3 % (535 of 586) | 93.1 % (121 of 130) |
Backbone | 92.3 % (655 of 710) | 92.1 % (220 of 239) | 92.1 % (328 of 356) | 93.0 % (107 of 115) |
Sidechain | 90.9 % (811 of 892) | 90.6 % (481 of 531) | 91.3 % (316 of 346) | 93.3 % (14 of 15) |
Aromatic | 75.0 % (123 of 164) | 75.6 % (62 of 82) | 74.1 % (60 of 81) | 100.0 % (1 of 1) |
Methyl | 99.3 % (141 of 142) | 98.6 % (70 of 71) | 100.0 % (71 of 71) |
1. SSP0047
MTLELQLKHY ITNLFNLPRD EKWECESIEE VADDILPDQY VRLGPLSNKI LQTNTYYSDT LHKSNIYPFI LYYQKQLIAI GFIDENHDMD FLYLHNTVMP LLDQRYLLTG GQLEHHHHHHSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 (±0.5) K, pH 6.5 (±0.1), Details slow precipitator
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 10 (±0.5) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 0.3 (±0.05) mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 273 (±0.5) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | MES | natural abundance | 20 (±1.0) mM | |
10 | sodium chloride | natural abundance | 100 (±5.0) mM | |
11 | calcium chloride | natural abundance | 5 (±0.25) mM | |
12 | DTT | natural abundance | 10 (±0.5) mM | |
13 | sodium azide | natural abundance | 0.02 (±0.001) % | |
14 | protein | [U-100% 13C; U-100% 15N] | 0.3 (±0.05) mM | |
15 | D2O | natural abundance | 100 % |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 (±0.5) K, pH 6.5 (±0.1), Details slow precipitator
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | MES | natural abundance | 20 (±1.0) mM | |
17 | sodium chloride | natural abundance | 100 (±10.0) mM | |
18 | calcium chloride | natural abundance | 5 (±0.25) mM | |
19 | DTT | natural abundance | 10 (±0.5) mM | |
20 | sodium azide | natural abundance | 0.02 (±0.001) % | |
21 | protein | [U-5% 13C; U-100% 15N] | 0.3 (±0.05) mM | |
22 | H2O | natural abundance | 95 % | |
23 | D2O | natural abundance | 5 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 (±0.5) K, pH 6.5 (±0.1), Details slow precipitator
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 10 (±0.5) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 0.3 (±0.05) mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 (±0.5) K, pH 6.5 (±0.1), Details slow precipitator
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 10 (±0.5) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 0.3 (±0.05) mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 (±0.5) K, pH 6.5 (±0.1), Details slow precipitator
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 10 (±0.5) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 0.3 (±0.05) mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 (±0.5) K, pH 6.5 (±0.1), Details slow precipitator
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 10 (±0.5) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 0.3 (±0.05) mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 273 (±0.5) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | MES | natural abundance | 20 (±1.0) mM | |
10 | sodium chloride | natural abundance | 100 (±5.0) mM | |
11 | calcium chloride | natural abundance | 5 (±0.25) mM | |
12 | DTT | natural abundance | 10 (±0.5) mM | |
13 | sodium azide | natural abundance | 0.02 (±0.001) % | |
14 | protein | [U-100% 13C; U-100% 15N] | 0.3 (±0.05) mM | |
15 | D2O | natural abundance | 100 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 (±0.5) K, pH 6.5 (±0.1), Details slow precipitator
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 10 (±0.5) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 0.3 (±0.05) mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 273 (±0.5) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | MES | natural abundance | 20 (±1.0) mM | |
10 | sodium chloride | natural abundance | 100 (±5.0) mM | |
11 | calcium chloride | natural abundance | 5 (±0.25) mM | |
12 | DTT | natural abundance | 10 (±0.5) mM | |
13 | sodium azide | natural abundance | 0.02 (±0.001) % | |
14 | protein | [U-100% 13C; U-100% 15N] | 0.3 (±0.05) mM | |
15 | D2O | natural abundance | 100 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 (±0.5) K, pH 6.5 (±0.1), Details slow precipitator
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 10 (±0.5) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 0.3 (±0.05) mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 (±0.5) K, pH 6.5 (±0.1), Details slow precipitator
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 10 (±0.5) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 0.3 (±0.05) mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 (±0.5) K, pH 6.5 (±0.1), Details slow precipitator
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 10 (±0.5) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 0.3 (±0.05) mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 (±0.5) K, pH 6.5 (±0.1), Details slow precipitator
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 10 (±0.5) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 0.3 (±0.05) mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 (±0.5) K, pH 6.5 (±0.1), Details slow precipitator
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 10 (±0.5) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 0.3 (±0.05) mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 (±0.5) K, pH 6.5 (±0.1), Details slow precipitator
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 10 (±0.5) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 0.3 (±0.05) mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 (±0.5) K, pH 6.5 (±0.1), Details slow precipitator
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 10 (±0.5) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 0.3 (±0.05) mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 (±0.5) K, pH 6.5 (±0.1), Details slow precipitator
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 10 (±0.5) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 0.3 (±0.05) mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 273 (±0.5) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | MES | natural abundance | 20 (±1.0) mM | |
10 | sodium chloride | natural abundance | 100 (±5.0) mM | |
11 | calcium chloride | natural abundance | 5 (±0.25) mM | |
12 | DTT | natural abundance | 10 (±0.5) mM | |
13 | sodium azide | natural abundance | 0.02 (±0.001) % | |
14 | protein | [U-100% 13C; U-100% 15N] | 0.3 (±0.05) mM | |
15 | D2O | natural abundance | 100 % |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 273 (±0.5) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | MES | natural abundance | 20 (±1.0) mM | |
10 | sodium chloride | natural abundance | 100 (±5.0) mM | |
11 | calcium chloride | natural abundance | 5 (±0.25) mM | |
12 | DTT | natural abundance | 10 (±0.5) mM | |
13 | sodium azide | natural abundance | 0.02 (±0.001) % | |
14 | protein | [U-100% 13C; U-100% 15N] | 0.3 (±0.05) mM | |
15 | D2O | natural abundance | 100 % |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 (±0.5) K, pH 6.5 (±0.1), Details slow precipitator
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | MES | natural abundance | 20 (±1.0) mM | |
17 | sodium chloride | natural abundance | 100 (±10.0) mM | |
18 | calcium chloride | natural abundance | 5 (±0.25) mM | |
19 | DTT | natural abundance | 10 (±0.5) mM | |
20 | sodium azide | natural abundance | 0.02 (±0.001) % | |
21 | protein | [U-5% 13C; U-100% 15N] | 0.3 (±0.05) mM | |
22 | H2O | natural abundance | 95 % | |
23 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 273 (±0.5) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | MES | natural abundance | 20 (±1.0) mM | |
10 | sodium chloride | natural abundance | 100 (±5.0) mM | |
11 | calcium chloride | natural abundance | 5 (±0.25) mM | |
12 | DTT | natural abundance | 10 (±0.5) mM | |
13 | sodium azide | natural abundance | 0.02 (±0.001) % | |
14 | protein | [U-100% 13C; U-100% 15N] | 0.3 (±0.05) mM | |
15 | D2O | natural abundance | 100 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_16072_2kcd.nef |
Input source #2: Coordindates | 2kcd.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MTLELQLKHYITNLFNLPRDEKWECESIEEVADDILPDQYVRLGPLSNKILQTNTYYSDTLHKSNIYPFILYYQKQLIAIGFIDENHDMDFLYLHNTVMP |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MTLELQLKHYITNLFNLPRDEKWECESIEEVADDILPDQYVRLGPLSNKILQTNTYYSDTLHKSNIYPFILYYQKQLIAIGFIDENHDMDFLYLHNTVMP -------110-------120 LLDQRYLLTGGQLEHHHHHH |||||||||||||||||||| LLDQRYLLTGGQLEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 120 | 0 | 0 | 100.0 |
Content subtype: combined_16072_2kcd.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MTLELQLKHYITNLFNLPRDEKWECESIEEVADDILPDQYVRLGPLSNKILQTNTYYSDTLHKSNIYPFILYYQKQLIAIGFIDENHDMDFLYLHNTVMP ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .TLELQLKHYITNLFNLPRDEKWECESIEEVADDILPDQYVRLGPLSNKILQTNTYYSDTLHKSNIYPFILYYQKQLIAIGFIDENHDMDFLYLHNTVMP --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120 LLDQRYLLTGGQLEHHHHHH |||||||||||||| LLDQRYLLTGGQLE -------110----
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
13 | ASN | CG | 176.2 |
16 | ASN | CG | 178.3 |
39 | GLN | CD | 179.5 |
48 | ASN | CG | 178.0 |
52 | GLN | CD | 180.2 |
54 | ASN | CG | 178.0 |
65 | ASN | CG | 178.5 |
74 | GLN | CD | 180.3 |
76 | GLN | CD | 179.5 |
86 | ASN | CG | 177.5 |
104 | GLN | CD | 180.0 |
112 | GLN | CD | 180.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 770 | 712 | 92.5 |
13C chemical shifts | 586 | 535 | 91.3 |
15N chemical shifts | 133 | 120 | 90.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 239 | 223 | 93.3 |
13C chemical shifts | 240 | 219 | 91.2 |
15N chemical shifts | 115 | 106 | 92.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 531 | 489 | 92.1 |
13C chemical shifts | 346 | 316 | 91.3 |
15N chemical shifts | 18 | 14 | 77.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 74 | 73 | 98.6 |
13C chemical shifts | 74 | 73 | 98.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 82 | 62 | 75.6 |
13C chemical shifts | 81 | 60 | 74.1 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MTLELQLKHYITNLFNLPRDEKWECESIEEVADDILPDQYVRLGPLSNKILQTNTYYSDTLHKSNIYPFILYYQKQLIAIGFIDENHDMDFLYLHNTVMP ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .TLELQLKHYITNLFNLPRDEKWECESIEEVADDILPDQYVRLGPLSNKILQTNTYYSDTLHKSNIYPFILYYQKQLIAIGFIDENHDMDFLYLHNTVMP --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120 LLDQRYLLTGGQLEHHHHHH |||||||||||||| LLDQRYLLTGGQLE -------110----
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MTLELQLKHYITNLFNLPRDEKWECESIEEVADDILPDQYVRLGPLSNKILQTNTYYSDTLHKSNIYPFILYYQKQLIAIGFIDENHDMDFLYLHNTVMP ||||||||||||||| ||||||||||||||||| |||| ||| |||||||||||||||||||||||||| |||||||| ||| |||||| .TLELQLKHYITNLFN.PRDEKWECESIEEVADD..PDQY....PLS.KILQTNTYYSDTLHKSNIYPFILYYQ...IAIGFIDE..DMD.LYLHNT... --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120 LLDQRYLLTGGQLEHHHHHH |||||||| ..DQRYLLTG -------110