SOLUTION NMR STRUCTURE OF THE OB-FOLD DOMAIN OF HEME CHAPERONE CCME FROM DESULFOVIBRIO VULGARIS. NORTHEAST STRUCTURAL GENOMICS TARGET DVR115G.
MATPQDKLHT VRLFGTVAAD GLTMLDGAPG VRFRLEDKDN TSKTVWVLYK GAVPDTFKPG VEVIIEGGLA PGEDTFKART LMTKCPLEHH HHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 90.6 % (968 of 1069) | 90.0 % (495 of 550) | 91.1 % (390 of 428) | 91.2 % (83 of 91) |
Backbone | 91.1 % (503 of 552) | 90.1 % (172 of 191) | 91.9 % (251 of 273) | 90.9 % (80 of 88) |
Sidechain | 90.2 % (543 of 602) | 90.0 % (323 of 359) | 90.4 % (217 of 240) | 100.0 % (3 of 3) |
Aromatic | 68.2 % (60 of 88) | 68.2 % (30 of 44) | 67.4 % (29 of 43) | 100.0 % (1 of 1) |
Methyl | 95.5 % (105 of 110) | 94.5 % (52 of 55) | 96.4 % (53 of 55) |
1. DvR115G
MATPQDKLHT VRLFGTVAAD GLTMLDGAPG VRFRLEDKDN TSKTVWVLYK GAVPDTFKPG VEVIIEGGLA PGEDTFKART LMTKCPLEHH HHHHSolvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DvR115G | [U-100% 13C; U-100% 15N] | 1.3 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM |
Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | DvR115G | [U-5% 13C; U-100% 15N] | 0.56 mM | |
9 | ammonium acetate | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 200 mM | |
11 | calcium chloride | natural abundance | 5 mM | |
12 | DTT | natural abundance | 10 mM | |
13 | sodium azide | natural abundance | 0.02 % | |
14 | DSS | natural abundance | 50 uM |
Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 298 K, pH 4.5, Details Aligned sample for RDCs contains 70% v/v of the [U-5% 13C; U-100% 15N] DvR115G sample 2, 4.2% PEG/hexanol, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | DvR115G | [U-5% 13C; U-100% 15N] | 70 % v/v | |
16 | PEG/hexanol | natural abundance | 4.2 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Pressure 1.0 atm, Temperature 298 K, pH 4.5
Experiment name 2D 1H-15N TROSY (for N-H RDCs)
List #1 RDC_list_1, RDC code 1DHNN, Field strength (1H) 600 MHz
Bruker Avance - 800 MHz 5-mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DvR115G | [U-100% 13C; U-100% 15N] | 1.3 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM |
Bruker Avance - 800 MHz 5-mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DvR115G | [U-100% 13C; U-100% 15N] | 1.3 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM |
Bruker Avance - 800 MHz 5-mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DvR115G | [U-100% 13C; U-100% 15N] | 1.3 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM |
Bruker Avance - 800 MHz 5-mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DvR115G | [U-100% 13C; U-100% 15N] | 1.3 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM |
Bruker Avance - 800 MHz 5-mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | DvR115G | [U-5% 13C; U-100% 15N] | 0.56 mM | |
9 | ammonium acetate | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 200 mM | |
11 | calcium chloride | natural abundance | 5 mM | |
12 | DTT | natural abundance | 10 mM | |
13 | sodium azide | natural abundance | 0.02 % | |
14 | DSS | natural abundance | 50 uM |
Varian INOVA - 600 MHz 5-mm cold probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DvR115G | [U-100% 13C; U-100% 15N] | 1.3 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM |
Varian INOVA - 600 MHz 5-mm cold probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DvR115G | [U-100% 13C; U-100% 15N] | 1.3 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM |
Varian INOVA - 600 MHz 5-mm cold probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DvR115G | [U-100% 13C; U-100% 15N] | 1.3 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM |
Varian INOVA - 600 MHz 5-mm cold probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DvR115G | [U-100% 13C; U-100% 15N] | 1.3 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM |
Varian INOVA - 600 MHz 5-mm cold probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DvR115G | [U-100% 13C; U-100% 15N] | 1.3 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM |
Varian INOVA - 600 MHz 5-mm cold probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DvR115G | [U-100% 13C; U-100% 15N] | 1.3 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM |
Varian INOVA - 600 MHz 5-mm cold probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DvR115G | [U-100% 13C; U-100% 15N] | 1.3 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM |
Bruker Avance - 600 MHz 5-mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DvR115G | [U-100% 13C; U-100% 15N] | 1.3 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM |
Bruker Avance - 600 MHz 5-mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DvR115G | [U-100% 13C; U-100% 15N] | 1.3 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM |
Bruker Avance - 600 MHz 5-mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DvR115G | [U-100% 13C; U-100% 15N] | 1.3 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM |
Bruker Avance - 600 MHz 5-mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DvR115G | [U-100% 13C; U-100% 15N] | 1.3 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM |
Bruker Avance - 600 MHz 5-mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DvR115G | [U-100% 13C; U-100% 15N] | 1.3 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM |
Bruker Avance - 600 MHz 5-mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DvR115G | [U-100% 13C; U-100% 15N] | 1.3 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM |
Varian INOVA - 600 MHz 5-mm cold probe
State anisotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 298 K, pH 4.5, Details Aligned sample for RDCs contains 70% v/v of the [U-5% 13C; U-100% 15N] DvR115G sample 2, 4.2% PEG/hexanol, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | DvR115G | [U-5% 13C; U-100% 15N] | 70 % v/v | |
16 | PEG/hexanol | natural abundance | 4.2 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_16096_2kct.nef |
Input source #2: Coordindates | 2kct.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
------50--------60--------70--------80--------90-------100-------110-------120-------130------ MATPQDKLHTVRLFGTVAADGLTMLDGAPGVRFRLEDKDNTSKTVWVLYKGAVPDTFKPGVEVIIEGGLAPGEDTFKARTLMTKCPLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MATPQDKLHTVRLFGTVAADGLTMLDGAPGVRFRLEDKDNTSKTVWVLYKGAVPDTFKPGVEVIIEGGLAPGEDTFKARTLMTKCPLEHHHHHH --------10--------20--------30--------40--------50--------60--------70--------80--------90----
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 94 | 0 | 0 | 100.0 |
Content subtype: combined_16096_2kct.nef
Assigned chemical shifts
------50--------60--------70--------80--------90-------100-------110-------120-------130------ MATPQDKLHTVRLFGTVAADGLTMLDGAPGVRFRLEDKDNTSKTVWVLYKGAVPDTFKPGVEVIIEGGLAPGEDTFKARTLMTKCPLEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .ATPQDKLHTVRLFGTVAADGLTMLDGAPGVRFRLEDKDNTSKTVWVLYKGAVPDTFKPGVEVIIEGGLAPGEDTFKARTLMTKCPLE ------50--------60--------70--------80--------90-------100-------110-------120-------130
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
47 | GLN | CD | 180.493 |
82 | ASN | CG | 177.726 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 550 | 504 | 91.6 |
13C chemical shifts | 428 | 390 | 91.1 |
15N chemical shifts | 95 | 87 | 91.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 191 | 176 | 92.1 |
13C chemical shifts | 188 | 173 | 92.0 |
15N chemical shifts | 88 | 80 | 90.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 359 | 328 | 91.4 |
13C chemical shifts | 240 | 217 | 90.4 |
15N chemical shifts | 7 | 7 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 58 | 57 | 98.3 |
13C chemical shifts | 58 | 57 | 98.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 44 | 30 | 68.2 |
13C chemical shifts | 43 | 29 | 67.4 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
------50--------60--------70--------80--------90-------100-------110-------120-------130------ MATPQDKLHTVRLFGTVAADGLTMLDGAPGVRFRLEDKDNTSKTVWVLYKGAVPDTFKPGVEVIIEGGLAPGEDTFKARTLMTKCPLEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .ATPQDKLHTVRLFGTVAADGLTMLDGAPGVRFRLEDKDNTSKTVWVLYKGAVPDTFKPGVEVIIEGGLAPGEDTFKARTLMTKCPLE ------50--------60--------70--------80--------90-------100-------110-------120-------130
Dihedral angle restraints
------50--------60--------70--------80--------90-------100-------110-------120-------130------ MATPQDKLHTVRLFGTVAADGLTMLDGAPGVRFRLEDKDNTSKTVWVLYKGAVPDTFKPGVEVIIEGGLAPGEDTFKARTLMTKCPLEHHHHHH ||||||||| ||| ||||||||| ||||||||||||| |||||||||||| ||||||||||||| .........TVRLFGTVA....TML....GVRFRLEDK....KTVWVLYKGAVPD....GVEVIIEGGLAP..DTFKARTLMTKCP ------50--------60--------70--------80--------90-------100-------110-------120--------
RDC restraints
------50--------60--------70--------80--------90-------100-------110-------120-------130------ MATPQDKLHTVRLFGTVAADGLTMLDGAPGVRFRLEDKDNTSKTVWVLYKGAVPDTFKPGVEVIIEGGLAPGEDTFKARTLMTKCPLEHHHHHH | ||||||||| |||| || |||| || | ||||| |||| || || ||||| |||||| | | ..........V.LFGTVAADG.TMLD...GV.FRLE.....SK..W.LYKGA..DTFK.GV.VI.EGGLA..EDTFKA.T...K ------50--------60--------70--------80--------90-------100-------110-------120------