1H, 13C, and 15N chemical shift assignments for murine FAIM-CTD
GPLGSENRSK TTSTWVLRLD GEDLRVVLEK DTMDVWCNGQ KMETAGEFVD DGTETHFSVG NHDCYIKAVS SGKRKEGIIH TLIVDNREIP ELTQ
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 86.5 % (916 of 1059) | 84.5 % (463 of 548) | 87.6 % (360 of 411) | 93.0 % (93 of 100) |
Backbone | 90.5 % (507 of 560) | 89.7 % (175 of 195) | 90.1 % (246 of 273) | 93.5 % (86 of 92) |
Sidechain | 83.2 % (486 of 584) | 81.6 % (288 of 353) | 85.7 % (191 of 223) | 87.5 % (7 of 8) |
Aromatic | 75.0 % (48 of 64) | 84.4 % (27 of 32) | 63.3 % (19 of 30) | 100.0 % (2 of 2) |
Methyl | 95.1 % (97 of 102) | 94.1 % (48 of 51) | 96.1 % (49 of 51) |
1. FAIM-CTD
GPLGSENRSK TTSTWVLRLD GEDLRVVLEK DTMDVWCNGQ KMETAGEFVD DGTETHFSVG NHDCYIKAVS SGKRKEGIIH TLIVDNREIP ELTQSolvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FAIM-CTD | [U-99% 13C; U-99% 15N] | 0.25 ~ 0.5 mM | |
2 | sodium chloride | natural abundance | 10 mM | |
3 | TRIS | natural abundance | 10 mM | |
4 | DTT | natural abundance | 5 mM |
Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | FAIM-CTD | [U-99% 13C; U-99% 15N] | 0.25 mM | |
6 | sodium chloride | natural abundance | 10 mM | |
7 | TRIS | natural abundance | 10 mM | |
8 | DTT | natural abundance | 5 mM | |
9 | Pf1 filamentous phage | natural abundance | 0.6% w/v |
Solvent system 100% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | FAIM-CTD | [U-99% 13C] | 1.8 mM | |
11 | sodium chloride | natural abundance | 10 mM | |
12 | TRIS | natural abundance | 10 mM | |
13 | DTT | natural abundance | 5 mM |
Solvent system 100% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
14 | FAIM-CTD | [U-10% 13C] | 0.5 mM | |
15 | sodium chloride | natural abundance | 10 mM | |
16 | TRIS | natural abundance | 10 mM | |
17 | DTT | natural abundance | 5 mM |
Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
18 | FAIM-CTD | [U-99% 15N] | 0.25 ~ 0.9 mM | |
19 | sodium chloride | natural abundance | 10 mM | |
20 | TRIS | natural abundance | 10 mM | |
21 | DTT | natural abundance | 5 mM |
Solvent system 100% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
22 | FAIM-CTD | natural abundance | 1.4 mM | |
23 | sodium chloride | natural abundance | 10 mM | |
24 | TRIS | natural abundance | 10 mM | |
25 | DTT | natural abundance | 5 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Pressure 1.0 atm, Temperature 298 K, pH 7.3
Experiment name 3D HNCO
List #1 HN_RDC, RDC code DHN, Field strength (1H) 499.9548 MHz
Varian INOVA - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FAIM-CTD | [U-99% 13C; U-99% 15N] | 0.25 ~ 0.5 mM | |
2 | sodium chloride | natural abundance | 10 mM | |
3 | TRIS | natural abundance | 10 mM | |
4 | DTT | natural abundance | 5 mM |
Varian INOVA - 500 MHz
State anisotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | FAIM-CTD | [U-99% 13C; U-99% 15N] | 0.25 mM | |
6 | sodium chloride | natural abundance | 10 mM | |
7 | TRIS | natural abundance | 10 mM | |
8 | DTT | natural abundance | 5 mM | |
9 | Pf1 filamentous phage | natural abundance | 0.6% w/v |
Varian INOVA - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | FAIM-CTD | [U-99% 13C; U-99% 15N] | 0.25 mM | |
6 | sodium chloride | natural abundance | 10 mM | |
7 | TRIS | natural abundance | 10 mM | |
8 | DTT | natural abundance | 5 mM | |
9 | Pf1 filamentous phage | natural abundance | 0.6% w/v |
Varian INOVA - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FAIM-CTD | [U-99% 13C; U-99% 15N] | 0.25 ~ 0.5 mM | |
2 | sodium chloride | natural abundance | 10 mM | |
3 | TRIS | natural abundance | 10 mM | |
4 | DTT | natural abundance | 5 mM |
Varian INOVA - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FAIM-CTD | [U-99% 13C; U-99% 15N] | 0.25 ~ 0.5 mM | |
2 | sodium chloride | natural abundance | 10 mM | |
3 | TRIS | natural abundance | 10 mM | |
4 | DTT | natural abundance | 5 mM |
Varian INOVA - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FAIM-CTD | [U-99% 13C; U-99% 15N] | 0.25 ~ 0.5 mM | |
2 | sodium chloride | natural abundance | 10 mM | |
3 | TRIS | natural abundance | 10 mM | |
4 | DTT | natural abundance | 5 mM |
Varian INOVA - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FAIM-CTD | [U-99% 13C; U-99% 15N] | 0.25 ~ 0.5 mM | |
2 | sodium chloride | natural abundance | 10 mM | |
3 | TRIS | natural abundance | 10 mM | |
4 | DTT | natural abundance | 5 mM |
Varian INOVA - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FAIM-CTD | [U-99% 13C; U-99% 15N] | 0.25 ~ 0.5 mM | |
2 | sodium chloride | natural abundance | 10 mM | |
3 | TRIS | natural abundance | 10 mM | |
4 | DTT | natural abundance | 5 mM |
Varian INOVA - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FAIM-CTD | [U-99% 13C; U-99% 15N] | 0.25 ~ 0.5 mM | |
2 | sodium chloride | natural abundance | 10 mM | |
3 | TRIS | natural abundance | 10 mM | |
4 | DTT | natural abundance | 5 mM |
Varian INOVA - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
18 | FAIM-CTD | [U-99% 15N] | 0.25 ~ 0.9 mM | |
19 | sodium chloride | natural abundance | 10 mM | |
20 | TRIS | natural abundance | 10 mM | |
21 | DTT | natural abundance | 5 mM |
Varian INOVA - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
18 | FAIM-CTD | [U-99% 15N] | 0.25 ~ 0.9 mM | |
19 | sodium chloride | natural abundance | 10 mM | |
20 | TRIS | natural abundance | 10 mM | |
21 | DTT | natural abundance | 5 mM |
Varian INOVA - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FAIM-CTD | [U-99% 13C; U-99% 15N] | 0.25 ~ 0.5 mM | |
2 | sodium chloride | natural abundance | 10 mM | |
3 | TRIS | natural abundance | 10 mM | |
4 | DTT | natural abundance | 5 mM |
Varian INOVA - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FAIM-CTD | [U-99% 13C; U-99% 15N] | 0.25 ~ 0.5 mM | |
2 | sodium chloride | natural abundance | 10 mM | |
3 | TRIS | natural abundance | 10 mM | |
4 | DTT | natural abundance | 5 mM |
Bruker Avance - 900 MHz
State isotropic, Solvent system 100% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | FAIM-CTD | [U-99% 13C] | 1.8 mM | |
11 | sodium chloride | natural abundance | 10 mM | |
12 | TRIS | natural abundance | 10 mM | |
13 | DTT | natural abundance | 5 mM |
Bruker Avance - 900 MHz
State isotropic, Solvent system 100% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | FAIM-CTD | [U-99% 13C] | 1.8 mM | |
11 | sodium chloride | natural abundance | 10 mM | |
12 | TRIS | natural abundance | 10 mM | |
13 | DTT | natural abundance | 5 mM |
Bruker Avance - 900 MHz
State isotropic, Solvent system 100% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
22 | FAIM-CTD | natural abundance | 1.4 mM | |
23 | sodium chloride | natural abundance | 10 mM | |
24 | TRIS | natural abundance | 10 mM | |
25 | DTT | natural abundance | 5 mM |
Varian INOVA - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FAIM-CTD | [U-99% 13C; U-99% 15N] | 0.25 ~ 0.5 mM | |
2 | sodium chloride | natural abundance | 10 mM | |
3 | TRIS | natural abundance | 10 mM | |
4 | DTT | natural abundance | 5 mM |
Varian INOVA - 500 MHz
State isotropic, Solvent system 100% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | FAIM-CTD | [U-99% 13C] | 1.8 mM | |
11 | sodium chloride | natural abundance | 10 mM | |
12 | TRIS | natural abundance | 10 mM | |
13 | DTT | natural abundance | 5 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_16103_2kd2.nef |
Input source #2: Coordindates | 2kd2.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
---90-------100-------110-------120-------130-------140-------150-------160-------170--------- GPLGSENRSKTTSTWVLRLDGEDLRVVLEKDTMDVWCNGQKMETAGEFVDDGTETHFSVGNHDCYIKAVSSGKRKEGIIHTLIVDNREIPELTQ |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GPLGSENRSKTTSTWVLRLDGEDLRVVLEKDTMDVWCNGQKMETAGEFVDDGTETHFSVGNHDCYIKAVSSGKRKEGIIHTLIVDNREIPELTQ --------10--------20--------30--------40--------50--------60--------70--------80--------90----
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 94 | 0 | 0 | 100.0 |
Content subtype: combined_16103_2kd2.nef
Assigned chemical shifts
---90-------100-------110-------120-------130-------140-------150-------160-------170--------- GPLGSENRSKTTSTWVLRLDGEDLRVVLEKDTMDVWCNGQKMETAGEFVDDGTETHFSVGNHDCYIKAVSSGKRKEGIIHTLIVDNREIPELTQ |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ........SKTTSTWVLRLDGEDLRVVLEKDTMDVWCNGQKMETAGEFVDDGTETHFSVGNHDCYIKAVSSGKRKEGIIHTLIVDNREIPELTQ
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
100 | TRP | CG | 112.661 |
121 | TRP | CE2 | 138.891 |
121 | TRP | CG | 112.059 |
133 | PHE | CG | 139.4 |
141 | HIS | ND1 | 184.527 |
141 | HIS | NE2 | 176.107 |
147 | HIS | CG | 131.125 |
147 | HIS | ND1 | 183.318 |
147 | HIS | NE2 | 177.685 |
150 | TYR | CG | 128.946 |
150 | TYR | CZ | 156.913 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 548 | 459 | 83.8 |
13C chemical shifts | 411 | 357 | 86.9 |
15N chemical shifts | 105 | 92 | 87.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 195 | 173 | 88.7 |
13C chemical shifts | 188 | 167 | 88.8 |
15N chemical shifts | 92 | 85 | 92.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 353 | 286 | 81.0 |
13C chemical shifts | 223 | 190 | 85.2 |
15N chemical shifts | 13 | 7 | 53.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 53 | 50 | 94.3 |
13C chemical shifts | 53 | 51 | 96.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 32 | 27 | 84.4 |
13C chemical shifts | 30 | 19 | 63.3 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
---90-------100-------110-------120-------130-------140-------150-------160-------170--------- GPLGSENRSKTTSTWVLRLDGEDLRVVLEKDTMDVWCNGQKMETAGEFVDDGTETHFSVGNHDCYIKAVSSGKRKEGIIHTLIVDNREIPELTQ ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||| ..........TTSTWVLRLDGEDLRVVLEKDTMDVWCNGQKMETAGEFVDDGTETHFSVGNHDCYIKAVSS...KEGIIHTLIVDNREIPELTQ
Dihedral angle restraints
---90-------100-------110-------120-------130-------140-------150-------160-------170--------- GPLGSENRSKTTSTWVLRLDGEDLRVVLEKDTMDVWCNGQKMETAGEFVDDGTETHFSVGNHDCYIKAVSSGKRKEGIIHTLIVDNREIPELTQ |||||||||||||||||||||||||||| ||||||||||||||||||||| ||||||||| ||||||||||||||| ..........TTSTWVLRLDGEDLRVVLEKDTMDVWCN.QKMETAGEFVDDGTETHFSVG..DCYIKAVSS.....GIIHTLIVDNREIPE ---90-------100-------110-------120-------130-------140-------150-------160-------170------