Solution NMR structure of F5/8 type C-terminal domain of a putative chitobiase from Bacteroides thetaiotaomicron. Northeast Structural Genomics Consortium target BtR324B
MGTTISKSGW EVLSFTTQEA SGEGAGNGLA KCLIDGDTET FWHAKWQGGS DPLPYDIVID MKQNIQIAQV ELLPRGRGSN NPIKVVEFAA SEDNVNWTPI GRFGFTNQDA ALEYYVKSIK ARYIRLTIPD DGGNSTVAAI RELDVKGTII NLEHHHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 96.0 % (1737 of 1809) | 96.4 % (898 of 932) | 94.8 % (668 of 705) | 99.4 % (171 of 172) |
Backbone | 98.5 % (928 of 942) | 97.3 % (319 of 328) | 99.1 % (457 of 461) | 99.3 % (152 of 153) |
Sidechain | 94.2 % (951 of 1010) | 95.9 % (579 of 604) | 91.2 % (353 of 387) | 100.0 % (19 of 19) |
Aromatic | 72.8 % (115 of 158) | 84.8 % (67 of 79) | 58.7 % (44 of 75) | 100.0 % (4 of 4) |
Methyl | 98.9 % (176 of 178) | 97.8 % (87 of 89) | 100.0 % (89 of 89) |
1. btr324b
MGTTISKSGW EVLSFTTQEA SGEGAGNGLA KCLIDGDTET FWHAKWQGGS DPLPYDIVID MKQNIQIAQV ELLPRGRGSN NPIKVVEFAA SEDNVNWTPI GRFGFTNQDA ALEYYVKSIK ARYIRLTIPD DGGNSTVAAI RELDVKGTII NLEHHHHHHSolvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | btr324b | [U-100% 13C; U-100% 15N] | 1.1 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 mM |
Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | btr324b | [U-5% 13C; U-100% 15N] | 1.1 mM | |
8 | ammonium acetate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 200 mM | |
10 | calcium chloride | natural abundance | 5 mM | |
11 | DTT | natural abundance | 10 mM | |
12 | sodium azide | natural abundance | 0.02 mM |
Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 298 K, pH 4.5, Details Compressed polyacrylamide gel
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | btr324b | [U-5% 13C; U-100% 15N] | 1.1 mM | |
14 | ammonium acetate | natural abundance | 20 mM | |
15 | sodium chloride | natural abundance | 200 mM | |
16 | calcium chloride | natural abundance | 5 mM | |
17 | DTT | natural abundance | 10 mM | |
18 | sodium azide | natural abundance | 0.02 mM |
Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
19 | btr324b | [U-5% 13C; U-100% 15N] | 1.1 mM | |
20 | ammonium acetate | natural abundance | 20 mM | |
21 | sodium chloride | natural abundance | 200 mM | |
22 | calcium chloride | natural abundance | 5 mM | |
23 | DTT | natural abundance | 10 mM | |
24 | sodium azide | natural abundance | 0.02 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
31P | DSS | methyl protons | 0.0 ppm | null | indirect | 0.4048086 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
31P | DSS | methyl protons | 0.0 ppm | null | indirect | 0.4048086 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
31P | DSS | methyl protons | 0.0 ppm | null | indirect | 0.4048086 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
31P | DSS | methyl protons | 0.0 ppm | null | indirect | 0.4048086 |
Pressure 1.0 atm, Temperature 298 K, pH 4.5
Experiment name 2D 1H-15N TROSY, 2D 1H-15N HSQC, 2D 1H-13C TROSY
List #1 RDC_list_1, RDC code DHN, Field strength (1H) 599.7664 MHz
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | btr324b | [U-100% 13C; U-100% 15N] | 1.1 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 mM |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | btr324b | [U-100% 13C; U-100% 15N] | 1.1 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 mM |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | btr324b | [U-100% 13C; U-100% 15N] | 1.1 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 mM |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | btr324b | [U-100% 13C; U-100% 15N] | 1.1 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 mM |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | btr324b | [U-100% 13C; U-100% 15N] | 1.1 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 mM |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | btr324b | [U-100% 13C; U-100% 15N] | 1.1 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 mM |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | btr324b | [U-100% 13C; U-100% 15N] | 1.1 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 mM |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | btr324b | [U-100% 13C; U-100% 15N] | 1.1 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 mM |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | btr324b | [U-100% 13C; U-100% 15N] | 1.1 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 mM |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | btr324b | [U-100% 13C; U-100% 15N] | 1.1 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 mM |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | btr324b | [U-100% 13C; U-100% 15N] | 1.1 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 mM |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | btr324b | [U-100% 13C; U-100% 15N] | 1.1 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 mM |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | btr324b | [U-100% 13C; U-100% 15N] | 1.1 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 mM |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | btr324b | [U-100% 13C; U-100% 15N] | 1.1 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 mM |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | btr324b | [U-100% 13C; U-100% 15N] | 1.1 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 mM |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | btr324b | [U-100% 13C; U-100% 15N] | 1.1 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 mM |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | btr324b | [U-100% 13C; U-100% 15N] | 1.1 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 mM |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | btr324b | [U-100% 13C; U-100% 15N] | 1.1 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 mM |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | btr324b | [U-100% 13C; U-100% 15N] | 1.1 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 mM |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | btr324b | [U-5% 13C; U-100% 15N] | 1.1 mM | |
8 | ammonium acetate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 200 mM | |
10 | calcium chloride | natural abundance | 5 mM | |
11 | DTT | natural abundance | 10 mM | |
12 | sodium azide | natural abundance | 0.02 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | btr324b | [U-5% 13C; U-100% 15N] | 1.1 mM | |
8 | ammonium acetate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 200 mM | |
10 | calcium chloride | natural abundance | 5 mM | |
11 | DTT | natural abundance | 10 mM | |
12 | sodium azide | natural abundance | 0.02 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | btr324b | [U-5% 13C; U-100% 15N] | 1.1 mM | |
8 | ammonium acetate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 200 mM | |
10 | calcium chloride | natural abundance | 5 mM | |
11 | DTT | natural abundance | 10 mM | |
12 | sodium azide | natural abundance | 0.02 mM |
Varian INOVA - 600 MHz
State anisotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 298 K, pH 4.5, Details Compressed polyacrylamide gel
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | btr324b | [U-5% 13C; U-100% 15N] | 1.1 mM | |
14 | ammonium acetate | natural abundance | 20 mM | |
15 | sodium chloride | natural abundance | 200 mM | |
16 | calcium chloride | natural abundance | 5 mM | |
17 | DTT | natural abundance | 10 mM | |
18 | sodium azide | natural abundance | 0.02 mM |
Varian INOVA - 600 MHz
State anisotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 298 K, pH 4.5, Details Compressed polyacrylamide gel
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | btr324b | [U-5% 13C; U-100% 15N] | 1.1 mM | |
14 | ammonium acetate | natural abundance | 20 mM | |
15 | sodium chloride | natural abundance | 200 mM | |
16 | calcium chloride | natural abundance | 5 mM | |
17 | DTT | natural abundance | 10 mM | |
18 | sodium azide | natural abundance | 0.02 mM |
Varian INOVA - 600 MHz
State anisotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
19 | btr324b | [U-5% 13C; U-100% 15N] | 1.1 mM | |
20 | ammonium acetate | natural abundance | 20 mM | |
21 | sodium chloride | natural abundance | 200 mM | |
22 | calcium chloride | natural abundance | 5 mM | |
23 | DTT | natural abundance | 10 mM | |
24 | sodium azide | natural abundance | 0.02 mM |
Varian INOVA - 600 MHz
State anisotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
19 | btr324b | [U-5% 13C; U-100% 15N] | 1.1 mM | |
20 | ammonium acetate | natural abundance | 20 mM | |
21 | sodium chloride | natural abundance | 200 mM | |
22 | calcium chloride | natural abundance | 5 mM | |
23 | DTT | natural abundance | 10 mM | |
24 | sodium azide | natural abundance | 0.02 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_16107_2kd7.nef |
Input source #2: Coordindates | 2kd7.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGTTISKSGWEVLSFTTQEASGEGAGNGLAKCLIDGDTETFWHAKWQGGSDPLPYDIVIDMKQNIQIAQVELLPRGRGSNNPIKVVEFAASEDNVNWTPI |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGTTISKSGWEVLSFTTQEASGEGAGNGLAKCLIDGDTETFWHAKWQGGSDPLPYDIVIDMKQNIQIAQVELLPRGRGSNNPIKVVEFAASEDNVNWTPI -------110-------120-------130-------140-------150--------- GRFGFTNQDAALEYYVKSIKARYIRLTIPDDGGNSTVAAIRELDVKGTIINLEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GRFGFTNQDAALEYYVKSIKARYIRLTIPDDGGNSTVAAIRELDVKGTIINLEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 159 | 0 | 0 | 100.0 |
Content subtype: combined_16107_2kd7.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGTTISKSGWEVLSFTTQEASGEGAGNGLAKCLIDGDTETFWHAKWQGGSDPLPYDIVIDMKQNIQIAQVELLPRGRGSNNPIKVVEFAASEDNVNWTPI ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .GTTISKSGWEVLSFTTQEASGEGAGNGLAKCLIDGDTETFWHAKWQGGSDPLPYDIVIDMKQNIQIAQVELLPRGRGSNNPIKVVEFAASEDNVNWTPI -------110-------120-------130-------140-------150--------- GRFGFTNQDAALEYYVKSIKARYIRLTIPDDGGNSTVAAIRELDVKGTIINLEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GRFGFTNQDAALEYYVKSIKARYIRLTIPDDGGNSTVAAIRELDVKGTIINLEHHHHHH
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
7 | LYS | HZ1 | 7.97 |
7 | LYS | HZ2 | 7.97 |
7 | LYS | HZ3 | 7.97 |
31 | LYS | HZ1 | 7.671 |
31 | LYS | HZ2 | 7.671 |
31 | LYS | HZ3 | 7.671 |
32 | CYS | HG | 1.892 |
40 | THR | HG1 | 10.027 |
43 | HIS | ND1 | 176.512 |
43 | HIS | NE2 | 209.878 |
45 | LYS | HZ1 | 7.261 |
45 | LYS | HZ2 | 7.261 |
45 | LYS | HZ3 | 7.261 |
55 | TYR | HH | 9.417 |
75 | ARG | HH11 | 6.93 |
75 | ARG | HH12 | 6.93 |
75 | ARG | HH21 | 6.818 |
75 | ARG | HH22 | 6.818 |
77 | ARG | HH11 | 7.102 |
77 | ARG | HH12 | 7.102 |
77 | ARG | HH21 | 7.102 |
77 | ARG | HH22 | 7.102 |
91 | SER | HG | 4.708 |
102 | ARG | HH11 | 7.146 |
102 | ARG | HH12 | 7.146 |
102 | ARG | HH21 | 6.493 |
102 | ARG | HH22 | 6.493 |
114 | TYR | HH | 8.192 |
117 | LYS | HZ1 | 7.601 |
117 | LYS | HZ2 | 7.601 |
117 | LYS | HZ3 | 7.601 |
122 | ARG | HH11 | 6.601 |
122 | ARG | HH12 | 6.601 |
122 | ARG | HH21 | 6.601 |
122 | ARG | HH22 | 6.601 |
125 | ARG | HH11 | 5.698 |
125 | ARG | HH12 | 5.698 |
125 | ARG | HH21 | 5.698 |
125 | ARG | HH22 | 5.698 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 932 | 912 | 97.9 |
13C chemical shifts | 705 | 669 | 94.9 |
15N chemical shifts | 178 | 176 | 98.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 328 | 325 | 99.1 |
13C chemical shifts | 318 | 316 | 99.4 |
15N chemical shifts | 153 | 151 | 98.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 604 | 587 | 97.2 |
13C chemical shifts | 387 | 353 | 91.2 |
15N chemical shifts | 25 | 25 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 91 | 90 | 98.9 |
13C chemical shifts | 91 | 90 | 98.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 79 | 67 | 84.8 |
13C chemical shifts | 75 | 44 | 58.7 |
15N chemical shifts | 4 | 4 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGTTISKSGWEVLSFTTQEASGEGAGNGLAKCLIDGDTETFWHAKWQGGSDPLPYDIVIDMKQNIQIAQVELLPRGRGSNNPIKVVEFAASEDNVNWTPI ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .GTTISKSGWEVLSFTTQEASGEGAGNGLAKCLIDGDTETFWHAKWQGGSDPLPYDIVIDMKQNIQIAQVELLPRGRGSNNPIKVVEFAASEDNVNWTPI --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150--------- GRFGFTNQDAALEYYVKSIKARYIRLTIPDDGGNSTVAAIRELDVKGTIINLEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GRFGFTNQDAALEYYVKSIKARYIRLTIPDDGGNSTVAAIRELDVKGTIINLEHHHH -------110-------120-------130-------140-------150-------
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGTTISKSGWEVLSFTTQEASGEGAGNGLAKCLIDGDTETFWHAKWQGGSDPLPYDIVIDMKQNIQIAQVELLPRGRGSNNPIKVVEFAASEDNVNWTPI |||| ||||| |||||||||| ||||||||| ||||||| |||||||||||| ||||||||| ||||| ..TTIS...WEVLS..........AGNGLAKCLI.GDTETFWHA..........YDIVIDM.QNIQIAQVELLP.........KVVEFAASE..VNWTP. --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150--------- GRFGFTNQDAALEYYVKSIKARYIRLTIPDDGGNSTVAAIRELDVKGTIINLEHHHHHH ||||||| ||| ||||||||||| |||||||||||||||||||| GRFGFTN....LEY...SIKARYIRLTI...GGNSTVAAIRELDVKGTIIN -------110-------120-------130-------140-------150-