Solution Structure of human ubiquitin-like domain of Herpud2_9_85, Northeast Structural Genomics Consortium (NESG) target HT53A
MGSSHHHHHH SSGRENLYFQ GHPVTLIIKA PNQKYSDQTI SCFLNWTVGK LKTHLSNVYP SKPLTKDQRL VYSGRLLPDH LQLKDILRKQ DEYHMVHLV
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 78.2 % (943 of 1206) | 80.2 % (505 of 630) | 76.9 % (362 of 471) | 72.4 % (76 of 105) |
Backbone | 77.1 % (450 of 584) | 77.3 % (153 of 198) | 77.7 % (227 of 292) | 74.5 % (70 of 94) |
Sidechain | 79.7 % (571 of 716) | 81.5 % (352 of 432) | 77.7 % (212 of 273) | 63.6 % (7 of 11) |
Aromatic | 50.0 % (58 of 116) | 62.1 % (36 of 58) | 36.8 % (21 of 57) | 100.0 % (1 of 1) |
Methyl | 100.0 % (104 of 104) | 100.0 % (52 of 52) | 100.0 % (52 of 52) |
1. humna ubiquitin-like domain of Herp
MGSSHHHHHH SSGRENLYFQ GHPVTLIIKA PNQKYSDQTI SCFLNWTVGK LKTHLSNVYP SKPLTKDQRL VYSGRLLPDH LQLKDILRKQ DEYHMVHLVSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | humna ubiquitin-like domain of Herp | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | TRIS | [U-100% 2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | sodium azide | natural abundance | 0.01 % | |
5 | benzamidine | natural abundance | 10 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | humna ubiquitin-like domain of Herp | [U-100% 13C; U-100% 15N] | 0.5 mM | |
9 | TRIS | [U-100% 2H] | 10 mM | |
10 | sodium chloride | natural abundance | 300 mM | |
11 | sodium azide | natural abundance | 0.01 % | |
12 | benzamidine | natural abundance | 10 mM | |
13 | D2O | natural abundance | 100 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
14 | humna ubiquitin-like domain of Herp | [U-7% 13C; U-100% 15N] | 0.5 mM | |
15 | TRIS | [U-100% 2H] | 10 mM | |
16 | sodium chloride | natural abundance | 300 mM | |
17 | sodium azide | natural abundance | 0.01 % | |
18 | benzamidine | natural abundance | 10 mM | |
19 | H2O | natural abundance | 90 % | |
20 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | humna ubiquitin-like domain of Herp | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | TRIS | [U-100% 2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | sodium azide | natural abundance | 0.01 % | |
5 | benzamidine | natural abundance | 10 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | humna ubiquitin-like domain of Herp | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | TRIS | [U-100% 2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | sodium azide | natural abundance | 0.01 % | |
5 | benzamidine | natural abundance | 10 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | humna ubiquitin-like domain of Herp | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | TRIS | [U-100% 2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | sodium azide | natural abundance | 0.01 % | |
5 | benzamidine | natural abundance | 10 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | humna ubiquitin-like domain of Herp | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | TRIS | [U-100% 2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | sodium azide | natural abundance | 0.01 % | |
5 | benzamidine | natural abundance | 10 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | humna ubiquitin-like domain of Herp | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | TRIS | [U-100% 2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | sodium azide | natural abundance | 0.01 % | |
5 | benzamidine | natural abundance | 10 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | humna ubiquitin-like domain of Herp | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | TRIS | [U-100% 2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | sodium azide | natural abundance | 0.01 % | |
5 | benzamidine | natural abundance | 10 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | humna ubiquitin-like domain of Herp | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | TRIS | [U-100% 2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | sodium azide | natural abundance | 0.01 % | |
5 | benzamidine | natural abundance | 10 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | humna ubiquitin-like domain of Herp | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | TRIS | [U-100% 2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | sodium azide | natural abundance | 0.01 % | |
5 | benzamidine | natural abundance | 10 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | humna ubiquitin-like domain of Herp | [U-100% 13C; U-100% 15N] | 0.5 mM | |
9 | TRIS | [U-100% 2H] | 10 mM | |
10 | sodium chloride | natural abundance | 300 mM | |
11 | sodium azide | natural abundance | 0.01 % | |
12 | benzamidine | natural abundance | 10 mM | |
13 | D2O | natural abundance | 100 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | humna ubiquitin-like domain of Herp | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | TRIS | [U-100% 2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | sodium azide | natural abundance | 0.01 % | |
5 | benzamidine | natural abundance | 10 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
14 | humna ubiquitin-like domain of Herp | [U-7% 13C; U-100% 15N] | 0.5 mM | |
15 | TRIS | [U-100% 2H] | 10 mM | |
16 | sodium chloride | natural abundance | 300 mM | |
17 | sodium azide | natural abundance | 0.01 % | |
18 | benzamidine | natural abundance | 10 mM | |
19 | H2O | natural abundance | 90 % | |
20 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_16109_2kdb.nef |
Input source #2: Coordindates | 2kdb.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
------------------------------10--------20--------30--------40--------50--------60--------70------- MGSSHHHHHHSSGRENLYFQGHPVTLIIKAPNQKYSDQTISCFLNWTVGKLKTHLSNVYPSKPLTKDQRLVYSGRLLPDHLQLKDILRKQDEYHMVHLV ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGSSHHHHHHSSGRENLYFQGHPVTLIIKAPNQKYSDQTISCFLNWTVGKLKTHLSNVYPSKPLTKDQRLVYSGRLLPDHLQLKDILRKQDEYHMVHLV --------10--------20--------30--------40--------50--------60--------70--------80--------90---------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 99 | 0 | 0 | 100.0 |
Content subtype: combined_16109_2kdb.nef
Assigned chemical shifts
------------------------------10--------20--------30--------40--------50--------60--------70------- MGSSHHHHHHSSGRENLYFQGHPVTLIIKAPNQKYSDQTISCFLNWTVGKLKTHLSNVYPSKPLTKDQRLVYSGRLLPDHLQLKDILRKQDEYHMVHLV ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ......................PVTLIIKAPNQKYSDQTISCFLNWTVGKLKTHLSNVYPSKPLTKDQRLVYSGRLLPDHLQLKDILRKQDEYHMVHLV
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 630 | 480 | 76.2 |
13C chemical shifts | 471 | 349 | 74.1 |
15N chemical shifts | 109 | 73 | 67.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 198 | 145 | 73.2 |
13C chemical shifts | 198 | 143 | 72.2 |
15N chemical shifts | 94 | 67 | 71.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 432 | 335 | 77.5 |
13C chemical shifts | 273 | 206 | 75.5 |
15N chemical shifts | 15 | 6 | 40.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 54 | 50 | 92.6 |
13C chemical shifts | 54 | 50 | 92.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 58 | 32 | 55.2 |
13C chemical shifts | 57 | 21 | 36.8 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
------------------------------10--------20--------30--------40--------50--------60--------70------- MGSSHHHHHHSSGRENLYFQGHPVTLIIKAPNQKYSDQTISCFLNWTVGKLKTHLSNVYPSKPLTKDQRLVYSGRLLPDHLQLKDILRKQDEYHMVHLV |||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ......................PVTLIIKAPN.KYSDQTISCFLNWTVGKLKTHLSNVYPSKPLTKDQRLVYSGRLLPDHLQLKDILRKQDEYHMVHLV
Dihedral angle restraints
------------------------------10--------20--------30--------40--------50--------60--------70------- MGSSHHHHHHSSGRENLYFQGHPVTLIIKAPNQKYSDQTISCFLNWTVGKLKTHLSNVYPSKPLTKDQRLVYSGRLLPDHLQLKDILRKQDEYHMVHLV |||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||| ......................PVTLIIKAPNQKYSDQTISCFLNWTVGKLKTHLSNVYPSK.LTKDQRLVYSGRLLPDHLQLKDILRKQDEYHMVHLV