Solution structure of PFE0790c, a putative bolA-like protein from the protozoan parasite Plasmodium falciparum: A Structural Genomics Center for Infectious Disease (SSGCID) community request.
MGSSHHHHHH SSGRENLYFQ GHMCIQKVIE DKLSSALKPT FLELVDKSCG CGTSFDAVIV SNNFEDKKLL DRHRLVNTIL KEELQNIHAF SMKCHTPLEY DKLKSKGS
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 80.0 % (1019 of 1273) | 78.8 % (523 of 664) | 80.4 % (398 of 495) | 86.0 % (98 of 114) |
Backbone | 83.7 % (539 of 644) | 83.6 % (184 of 220) | 83.3 % (265 of 318) | 84.9 % (90 of 106) |
Sidechain | 78.1 % (571 of 731) | 76.4 % (339 of 444) | 80.3 % (224 of 279) | 100.0 % (8 of 8) |
Aromatic | 47.2 % (50 of 106) | 47.2 % (25 of 53) | 47.2 % (25 of 53) | |
Methyl | 98.0 % (100 of 102) | 98.0 % (50 of 51) | 98.0 % (50 of 51) |
1. PFE0790c
MGSSHHHHHH SSGRENLYFQ GHMCIQKVIE DKLSSALKPT FLELVDKSCG CGTSFDAVIV SNNFEDKKLL DRHRLVNTIL KEELQNIHAF SMKCHTPLEY DKLKSKGSSolvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 1.5 (±0.5) mM | |
2 | sodium phosphate | natural abundance | 10 (±1.0) mM | |
3 | sodium chloride | natural abundance | 200 (±5.0) mM | |
4 | DTT | natural abundance | 10 (±1.0) mM | |
5 | sodium azide | natural abundance | 0.01 (±0.002) % | |
6 | benzamidine | natural abundance | 1 (±0.01) mM | |
7 | H2O | natural abundance | 93 % | |
8 | D2O | natural abundance | 7 % |
Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | entity | [U-7% 13C; U-99% 15N] | 1.5 (±0.5) mM | |
10 | sodium phosphate | natural abundance | 10 (±1.0) mM | |
11 | sodium chloride | natural abundance | 200 (±5.0) mM | |
12 | DTT | natural abundance | 10 (±1.0) mM | |
13 | sodium azide | natural abundance | 0.01 (±0.002) % | |
14 | benzamidine | natural abundance | 1 (±0.01) mM | |
15 | H2O | natural abundance | 93 % | |
16 | D2O | natural abundance | 7 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 1.5 (±0.5) mM | |
2 | sodium phosphate | natural abundance | 10 (±1.0) mM | |
3 | sodium chloride | natural abundance | 200 (±5.0) mM | |
4 | DTT | natural abundance | 10 (±1.0) mM | |
5 | sodium azide | natural abundance | 0.01 (±0.002) % | |
6 | benzamidine | natural abundance | 1 (±0.01) mM | |
7 | H2O | natural abundance | 93 % | |
8 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 1.5 (±0.5) mM | |
2 | sodium phosphate | natural abundance | 10 (±1.0) mM | |
3 | sodium chloride | natural abundance | 200 (±5.0) mM | |
4 | DTT | natural abundance | 10 (±1.0) mM | |
5 | sodium azide | natural abundance | 0.01 (±0.002) % | |
6 | benzamidine | natural abundance | 1 (±0.01) mM | |
7 | H2O | natural abundance | 93 % | |
8 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 1.5 (±0.5) mM | |
2 | sodium phosphate | natural abundance | 10 (±1.0) mM | |
3 | sodium chloride | natural abundance | 200 (±5.0) mM | |
4 | DTT | natural abundance | 10 (±1.0) mM | |
5 | sodium azide | natural abundance | 0.01 (±0.002) % | |
6 | benzamidine | natural abundance | 1 (±0.01) mM | |
7 | H2O | natural abundance | 93 % | |
8 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 1.5 (±0.5) mM | |
2 | sodium phosphate | natural abundance | 10 (±1.0) mM | |
3 | sodium chloride | natural abundance | 200 (±5.0) mM | |
4 | DTT | natural abundance | 10 (±1.0) mM | |
5 | sodium azide | natural abundance | 0.01 (±0.002) % | |
6 | benzamidine | natural abundance | 1 (±0.01) mM | |
7 | H2O | natural abundance | 93 % | |
8 | D2O | natural abundance | 7 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 1.5 (±0.5) mM | |
2 | sodium phosphate | natural abundance | 10 (±1.0) mM | |
3 | sodium chloride | natural abundance | 200 (±5.0) mM | |
4 | DTT | natural abundance | 10 (±1.0) mM | |
5 | sodium azide | natural abundance | 0.01 (±0.002) % | |
6 | benzamidine | natural abundance | 1 (±0.01) mM | |
7 | H2O | natural abundance | 93 % | |
8 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 1.5 (±0.5) mM | |
2 | sodium phosphate | natural abundance | 10 (±1.0) mM | |
3 | sodium chloride | natural abundance | 200 (±5.0) mM | |
4 | DTT | natural abundance | 10 (±1.0) mM | |
5 | sodium azide | natural abundance | 0.01 (±0.002) % | |
6 | benzamidine | natural abundance | 1 (±0.01) mM | |
7 | H2O | natural abundance | 93 % | |
8 | D2O | natural abundance | 7 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 1.5 (±0.5) mM | |
2 | sodium phosphate | natural abundance | 10 (±1.0) mM | |
3 | sodium chloride | natural abundance | 200 (±5.0) mM | |
4 | DTT | natural abundance | 10 (±1.0) mM | |
5 | sodium azide | natural abundance | 0.01 (±0.002) % | |
6 | benzamidine | natural abundance | 1 (±0.01) mM | |
7 | H2O | natural abundance | 93 % | |
8 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 1.5 (±0.5) mM | |
2 | sodium phosphate | natural abundance | 10 (±1.0) mM | |
3 | sodium chloride | natural abundance | 200 (±5.0) mM | |
4 | DTT | natural abundance | 10 (±1.0) mM | |
5 | sodium azide | natural abundance | 0.01 (±0.002) % | |
6 | benzamidine | natural abundance | 1 (±0.01) mM | |
7 | H2O | natural abundance | 93 % | |
8 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 1.5 (±0.5) mM | |
2 | sodium phosphate | natural abundance | 10 (±1.0) mM | |
3 | sodium chloride | natural abundance | 200 (±5.0) mM | |
4 | DTT | natural abundance | 10 (±1.0) mM | |
5 | sodium azide | natural abundance | 0.01 (±0.002) % | |
6 | benzamidine | natural abundance | 1 (±0.01) mM | |
7 | H2O | natural abundance | 93 % | |
8 | D2O | natural abundance | 7 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 1.5 (±0.5) mM | |
2 | sodium phosphate | natural abundance | 10 (±1.0) mM | |
3 | sodium chloride | natural abundance | 200 (±5.0) mM | |
4 | DTT | natural abundance | 10 (±1.0) mM | |
5 | sodium azide | natural abundance | 0.01 (±0.002) % | |
6 | benzamidine | natural abundance | 1 (±0.01) mM | |
7 | H2O | natural abundance | 93 % | |
8 | D2O | natural abundance | 7 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | entity | [U-7% 13C; U-99% 15N] | 1.5 (±0.5) mM | |
10 | sodium phosphate | natural abundance | 10 (±1.0) mM | |
11 | sodium chloride | natural abundance | 200 (±5.0) mM | |
12 | DTT | natural abundance | 10 (±1.0) mM | |
13 | sodium azide | natural abundance | 0.01 (±0.002) % | |
14 | benzamidine | natural abundance | 1 (±0.01) mM | |
15 | H2O | natural abundance | 93 % | |
16 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 1.5 (±0.5) mM | |
2 | sodium phosphate | natural abundance | 10 (±1.0) mM | |
3 | sodium chloride | natural abundance | 200 (±5.0) mM | |
4 | DTT | natural abundance | 10 (±1.0) mM | |
5 | sodium azide | natural abundance | 0.01 (±0.002) % | |
6 | benzamidine | natural abundance | 1 (±0.01) mM | |
7 | H2O | natural abundance | 93 % | |
8 | D2O | natural abundance | 7 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_16118_2kdn.nef |
Input source #2: Coordindates | 2kdn.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGSSHHHHHHSSGRENLYFQGHMCIQKVIEDKLSSALKPTFLELVDKSCGCGTSFDAVIVSNNFEDKKLLDRHRLVNTILKEELQNIHAFSMKCHTPLEY |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGSSHHHHHHSSGRENLYFQGHMCIQKVIEDKLSSALKPTFLELVDKSCGCGTSFDAVIVSNNFEDKKLLDRHRLVNTILKEELQNIHAFSMKCHTPLEY -------- DKLKSKGS |||||||| DKLKSKGS
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 108 | 0 | 0 | 100.0 |
Content subtype: combined_16118_2kdn.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGSSHHHHHHSSGRENLYFQGHMCIQKVIEDKLSSALKPTFLELVDKSCGCGTSFDAVIVSNNFEDKKLLDRHRLVNTILKEELQNIHAFSMKCHTPLEY ||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||| ..........SSGRENLYFQGHMCIQKVIEDKLSSALKPTFLELVDK......SFDAVIVSNNFEDKKLLDRHRLVNTILKEELQNIHAFSMKCHTPLEY -------- DKLKSKGS |||||||| DKLKSKGS
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
62 | ASN | CG | 176.6 |
91 | SER | HG | 1.95 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 664 | 504 | 75.9 |
13C chemical shifts | 495 | 390 | 78.8 |
15N chemical shifts | 117 | 95 | 81.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 220 | 178 | 80.9 |
13C chemical shifts | 216 | 169 | 78.2 |
15N chemical shifts | 106 | 87 | 82.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 444 | 326 | 73.4 |
13C chemical shifts | 279 | 221 | 79.2 |
15N chemical shifts | 11 | 8 | 72.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 54 | 51 | 94.4 |
13C chemical shifts | 54 | 52 | 96.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 53 | 25 | 47.2 |
13C chemical shifts | 53 | 25 | 47.2 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGSSHHHHHHSSGRENLYFQGHMCIQKVIEDKLSSALKPTFLELVDKSCGCGTSFDAVIVSNNFEDKKLLDRHRLVNTILKEELQNIHAFSMKCHTPLEY |||||||||||| |||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||| ..........SSGRENLYFQGH.CIQKVIEDKLSSALKPTFLELVDK......SFDAVIVSNNFEDKKLLDRHRLVNTILKEELQNIHAFSMKCHTPLEY -------- DKLKSKGS |||||||| DKLKSKGS
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGSSHHHHHHSSGRENLYFQGHMCIQKVIEDKLSSALKPTFLELVDKSCGCGTSFDAVIVSNNFEDKKLLDRHRLVNTILKEELQNIHAFSMKCHTPLEY ||||||||||||||| |||||||| ||||||||||||| |||||||||||||||||||||||||||||||||| .......................CIQKVIEDKLSSALK.TFLELVDK.....TSFDAVIVSNNFE.KKLLDRHRLVNTILKEELQNIHAFSMKCHTPLEY --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------- DKLKSKGS ||||| DKLKS -----