Structure of the human Shwachman-Bodian-Diamond syndrome protein, SBDS
GHMSIFTPTN QIRLTNVAVV RMKRAGKRFE IACYKNKVVG WRSGVEKDLD EVLQTHSVFV NVSKGQVAKK EDLISAFGTD DQTEICKQIL TKGEVQVSDK ERHTQLEQMF RDIATIVADK CVNPETKRPY TVILIERAMK DIHYSVKTNK STKQQALEVI KQLKEKMKIE RAHMRLRFIL PVNEGKKLKE KLKPLIKVIE SEDYGQQLEI VCLIDPGCFR EIDELIKKET KGKGSLEVLN LKDVEEGDEK FE
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 79.3 % (2435 of 3069) | 73.3 % (1187 of 1619) | 86.5 % (1022 of 1182) | 84.3 % (226 of 268) |
Backbone | 91.7 % (1375 of 1500) | 90.6 % (463 of 511) | 93.1 % (692 of 743) | 89.4 % (220 of 246) |
Sidechain | 71.0 % (1283 of 1808) | 65.3 % (724 of 1108) | 81.6 % (553 of 678) | 27.3 % (6 of 22) |
Aromatic | 27.8 % (40 of 144) | 38.9 % (28 of 72) | 15.5 % (11 of 71) | 100.0 % (1 of 1) |
Methyl | 88.0 % (264 of 300) | 88.0 % (132 of 150) | 88.0 % (132 of 150) |
1. SBDS
GHMSIFTPTN QIRLTNVAVV RMKRAGKRFE IACYKNKVVG WRSGVEKDLD EVLQTHSVFV NVSKGQVAKK EDLISAFGTD DQTEICKQIL TKGEVQVSDK ERHTQLEQMF RDIATIVADK CVNPETKRPY TVILIERAMK DIHYSVKTNK STKQQALEVI KQLKEKMKIE RAHMRLRFIL PVNEGKKLKE KLKPLIKVIE SEDYGQQLEI VCLIDPGCFR EIDELIKKET KGKGSLEVLN LKDVEEGDEK FESolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.2, Details sodium phosphate buffer
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SBDS | [U-100% 13C; U-100% 15N; U-80% 2H] | 0.5 mM | |
2 | DTT | no | 1.0 mM | |
3 | sodium phosphate | no | 50 mM | |
4 | sodium chloride | no | 20 mM | |
5 | sodium azide | no | 0.05 % | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.2, Details sodium phosphate buffer
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | SBDS | [U-99% 13C; U-99% 15N] | 0.5 mM | |
9 | DTT | no | 1.0 mM | |
10 | sodium phosphate | no | 50 mM | |
11 | sodium chloride | no | 20 mM | |
12 | sodium azide | no | 0.05 % | |
13 | H2O | natural abundance | 90 % | |
14 | D2O | natural abundance | 10 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 293 K, pH 7.2, Details sample_2 was liophilized and resuspended in 100% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | SBDS | [U-99% 13C; U-99% 15N] | 0.5 mM | |
16 | DTT | no | 1.0 mM | |
17 | sodium phosphate | no | 50 mM | |
18 | sodium chloride | no | 20 mM | |
19 | sodium azide | no | 0.05 % | |
20 | D2O | natural abundance | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | ubiquitin | methyl carbons | 43.0 ppm | external | indirect | 1.0 |
1H | water | protons | 4.87 ppm | na | direct | 1.0 |
15N | ubiquitin | nitrogen | 119.0 ppm | external | indirect | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | ubiquitin | methyl carbons | 43.0 ppm | external | indirect | 1.0 |
1H | water | protons | 4.87 ppm | na | direct | 1.0 |
15N | ubiquitin | nitrogen | 119.0 ppm | external | indirect | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | ubiquitin | methyl carbons | 43.0 ppm | external | indirect | 1.0 |
1H | water | protons | 4.87 ppm | na | direct | 1.0 |
15N | ubiquitin | nitrogen | 119.0 ppm | external | indirect | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | ubiquitin | methyl carbons | 43.0 ppm | external | indirect | 1.0 |
1H | water | protons | 4.87 ppm | na | direct | 1.0 |
15N | ubiquitin | nitrogen | 119.0 ppm | external | indirect | 1.0 |
Varian INOVA - 600 MHz with cryogenic probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.2, Details sodium phosphate buffer
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SBDS | [U-100% 13C; U-100% 15N; U-80% 2H] | 0.5 mM | |
2 | DTT | no | 1.0 mM | |
3 | sodium phosphate | no | 50 mM | |
4 | sodium chloride | no | 20 mM | |
5 | sodium azide | no | 0.05 % | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz with cryogenic probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.2, Details sodium phosphate buffer
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SBDS | [U-100% 13C; U-100% 15N; U-80% 2H] | 0.5 mM | |
2 | DTT | no | 1.0 mM | |
3 | sodium phosphate | no | 50 mM | |
4 | sodium chloride | no | 20 mM | |
5 | sodium azide | no | 0.05 % | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz with cryogenic probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.2, Details sodium phosphate buffer
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SBDS | [U-100% 13C; U-100% 15N; U-80% 2H] | 0.5 mM | |
2 | DTT | no | 1.0 mM | |
3 | sodium phosphate | no | 50 mM | |
4 | sodium chloride | no | 20 mM | |
5 | sodium azide | no | 0.05 % | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz with cryogenic probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.2, Details sodium phosphate buffer
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SBDS | [U-100% 13C; U-100% 15N; U-80% 2H] | 0.5 mM | |
2 | DTT | no | 1.0 mM | |
3 | sodium phosphate | no | 50 mM | |
4 | sodium chloride | no | 20 mM | |
5 | sodium azide | no | 0.05 % | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz with cryogenic probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.2, Details sodium phosphate buffer
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SBDS | [U-100% 13C; U-100% 15N; U-80% 2H] | 0.5 mM | |
2 | DTT | no | 1.0 mM | |
3 | sodium phosphate | no | 50 mM | |
4 | sodium chloride | no | 20 mM | |
5 | sodium azide | no | 0.05 % | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz with cryogenic probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.2, Details sodium phosphate buffer
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | SBDS | [U-99% 13C; U-99% 15N] | 0.5 mM | |
9 | DTT | no | 1.0 mM | |
10 | sodium phosphate | no | 50 mM | |
11 | sodium chloride | no | 20 mM | |
12 | sodium azide | no | 0.05 % | |
13 | H2O | natural abundance | 90 % | |
14 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz with cryogenic probe
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293 K, pH 7.2, Details sample_2 was liophilized and resuspended in 100% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | SBDS | [U-99% 13C; U-99% 15N] | 0.5 mM | |
16 | DTT | no | 1.0 mM | |
17 | sodium phosphate | no | 50 mM | |
18 | sodium chloride | no | 20 mM | |
19 | sodium azide | no | 0.05 % | |
20 | D2O | natural abundance | 100 % |
Varian INOVA - 600 MHz with cryogenic probe
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293 K, pH 7.2, Details sample_2 was liophilized and resuspended in 100% D2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | SBDS | [U-99% 13C; U-99% 15N] | 0.5 mM | |
16 | DTT | no | 1.0 mM | |
17 | sodium phosphate | no | 50 mM | |
18 | sodium chloride | no | 20 mM | |
19 | sodium azide | no | 0.05 % | |
20 | D2O | natural abundance | 100 % |
Varian INOVA - 600 MHz with cryogenic probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.2, Details sodium phosphate buffer
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | SBDS | [U-99% 13C; U-99% 15N] | 0.5 mM | |
9 | DTT | no | 1.0 mM | |
10 | sodium phosphate | no | 50 mM | |
11 | sodium chloride | no | 20 mM | |
12 | sodium azide | no | 0.05 % | |
13 | H2O | natural abundance | 90 % | |
14 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz with cryogenic probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.2, Details sodium phosphate buffer
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | SBDS | [U-99% 13C; U-99% 15N] | 0.5 mM | |
9 | DTT | no | 1.0 mM | |
10 | sodium phosphate | no | 50 mM | |
11 | sodium chloride | no | 20 mM | |
12 | sodium azide | no | 0.05 % | |
13 | H2O | natural abundance | 90 % | |
14 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.2, Details sodium phosphate buffer
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | SBDS | [U-99% 13C; U-99% 15N] | 0.5 mM | |
9 | DTT | no | 1.0 mM | |
10 | sodium phosphate | no | 50 mM | |
11 | sodium chloride | no | 20 mM | |
12 | sodium azide | no | 0.05 % | |
13 | H2O | natural abundance | 90 % | |
14 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz with cryogenic probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.2, Details sodium phosphate buffer
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | SBDS | [U-99% 13C; U-99% 15N] | 0.5 mM | |
9 | DTT | no | 1.0 mM | |
10 | sodium phosphate | no | 50 mM | |
11 | sodium chloride | no | 20 mM | |
12 | sodium azide | no | 0.05 % | |
13 | H2O | natural abundance | 90 % | |
14 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.2, Details sodium phosphate buffer
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | SBDS | [U-99% 13C; U-99% 15N] | 0.5 mM | |
9 | DTT | no | 1.0 mM | |
10 | sodium phosphate | no | 50 mM | |
11 | sodium chloride | no | 20 mM | |
12 | sodium azide | no | 0.05 % | |
13 | H2O | natural abundance | 90 % | |
14 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz with cryogenic probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.2, Details sodium phosphate buffer
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | SBDS | [U-99% 13C; U-99% 15N] | 0.5 mM | |
9 | DTT | no | 1.0 mM | |
10 | sodium phosphate | no | 50 mM | |
11 | sodium chloride | no | 20 mM | |
12 | sodium azide | no | 0.05 % | |
13 | H2O | natural abundance | 90 % | |
14 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.2, Details sodium phosphate buffer
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | SBDS | [U-99% 13C; U-99% 15N] | 0.5 mM | |
9 | DTT | no | 1.0 mM | |
10 | sodium phosphate | no | 50 mM | |
11 | sodium chloride | no | 20 mM | |
12 | sodium azide | no | 0.05 % | |
13 | H2O | natural abundance | 90 % | |
14 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_16119_2kdo.nef |
Input source #2: Coordindates | 2kdo.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GHMSIFTPTNQIRLTNVAVVRMKRAGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GHMSIFTPTNQIRLTNVAVVRMKRAGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDK -------110-------120-------130-------140-------150-------160-------170-------180-------190-------200 ERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVKTNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLIKVIE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVKTNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLIKVIE -------210-------220-------230-------240-------250-- SEDYGQQLEIVCLIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE |||||||||||||||||||||||||||||||||||||||||||||||||||| SEDYGQQLEIVCLIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 252 | 0 | 0 | 100.0 |
Content subtype: combined_16119_2kdo.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GHMSIFTPTNQIRLTNVAVVRMKRAGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDK ||||| |||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ....IFTPT.QIRLTNVAVVRMKRAGKRFEIACY...VVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQV... -------110-------120-------130-------140-------150-------160-------170-------180-------190-------200 ERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVKTNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLIKVIE |||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||| .......QMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVK....TKQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLIKVIE -------210-------220-------230-------240-------250-- SEDYGQQLEIVCLIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE |||||||||||||||||||||||||||||||||||||||||||||||||||| SEDYGQQLEIVCLIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
7 | THR | HG1 | 5.155 |
9 | THR | HG1 | 5.17 |
15 | THR | HG1 | 5.17 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 1619 | 1056 | 65.2 |
13C chemical shifts | 1182 | 979 | 82.8 |
15N chemical shifts | 281 | 216 | 76.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 511 | 450 | 88.1 |
13C chemical shifts | 504 | 458 | 90.9 |
15N chemical shifts | 246 | 212 | 86.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 1108 | 606 | 54.7 |
13C chemical shifts | 678 | 521 | 76.8 |
15N chemical shifts | 35 | 4 | 11.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 156 | 122 | 78.2 |
13C chemical shifts | 156 | 124 | 79.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 72 | 20 | 27.8 |
13C chemical shifts | 71 | 1 | 1.4 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GHMSIFTPTNQIRLTNVAVVRMKRAGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDK |||| |||||||||||||||||||||||| | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .....FTPT.QIRLTNVAVVRMKRAGKRFEIACY.N.VVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQV... -------110-------120-------130-------140-------150-------160-------170-------180-------190-------200 ERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVKTNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLIKVIE |||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||| .......QMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVK...STKQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLIKVIE -------210-------220-------230-------240-------250-- SEDYGQQLEIVCLIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE |||||||||||||||||||||||||||||||||||||||||||||||||||| SEDYGQQLEIVCLIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE