BMRBj - BMREntryMaster

Found 1 Document (0.629 seconds)

BMRB: 16147

2MMO

NMR assignments of oxidised thioredoxin from Plasmodium falciparum

Authors

Munte, C.E., Katja, B., Rolf, S.H., Hans, K.R.

Assembly

Trx

Entity

1. Trx (polymer, Thiol state: free and disulfide bound), 115 monomers, 12999.58 Da Detail

MRGSHHHHHH GSVKIVTSQS EFDSIISQNE LVIVDFFAEW CGPCKRIAPF YEECSKTYTK MVFIKVDVDE VSEVTEKENI TSMPTFKVYK NGSSVDTLLG ANDSALKQLI EKYAA

Formula weight

12999.58 Da

Entity Connection

disulfide 1 Detail

ID	Type	Value order	Atom ID 1	Atom ID 2
1	disulfide	sing	1:CYS41:SG	1:CYS44:SG

Source organism

Plasmodium falciparum

Exptl. method

solution NMR

Refine. method

simulated annealing

Data set

assigned_chemical_shifts

Chem. Shift Complete

Sequence coverage: 93.0 %, Completeness: 87.0 %, Completeness (bb): 90.9 % Detail

Polymer type: polypeptide(L)

	Total	¹H	¹³C	¹⁵N
All	87.0 % (1167 of 1341)	90.7 % (627 of 691)	82.1 % (435 of 530)	87.5 % (105 of 120)
Backbone	90.9 % (622 of 684)	89.7 % (208 of 232)	91.2 % (310 of 340)	92.9 % (104 of 112)
Sidechain	84.4 % (647 of 767)	91.3 % (419 of 459)	75.7 % (227 of 300)	12.5 % (1 of 8)
Aromatic	43.8 % (56 of 128)	79.7 % (51 of 64)	7.9 % (5 of 63)	0.0 % (0 of 1)
Methyl	100.0 % (122 of 122)	100.0 % (61 of 61)	100.0 % (61 of 61)

1. Trx

MRGSHHHHHH GSVKIVTSQS EFDSIISQNE LVIVDFFAEW CGPCKRIAPF YEECSKTYTK MVFIKVDVDE VSEVTEKENI TSMPTFKVYK NGSSVDTLLG ANDSALKQLI EKYAA

Show sample condition

Sample #1

Solvent system 100% D2O, Pressure 1 atm, Temperature 293 K, pH 7.0

#	Name	Isotope labeling	Concentration
1	Trx	[U-100% 13C; U-100% 15N]	1 mM
2	potassium phosphate	natural abundance	10 mM
3	DSS	natural abundance	0.1 mM
4	sodium azide	natural abundance	1 mM

Sample #2

Solvent system 92% H2O / 8% D2O, Pressure 1 atm, Temperature 293 K, pH 7.0

#	Name	Isotope labeling	Concentration
5	Trx	[U-100% 13C; U-100% 15N]	1 mM
6	potassium phosphate	natural abundance	10 mM
7	DSS	natural abundance	0.1 mM
8	sodium azide	natural abundance	1 mM
9	D2O	natural abundance	8 %

Sample #3

Solvent system 92% H2O / 8% D2O, Pressure 1 atm, Temperature 293 K, pH 7.0

#	Name	Isotope labeling	Concentration
10	Trx	natural abundance	1 mM
11	potassium phosphate	natural abundance	10 mM
12	DSS	natural abundance	0.1 mM
13	sodium azide	natural abundance	1 mM
14	D2O	natural abundance	8 %

LACS Plot; CA

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	null	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	null	indirect	0.1013291

Referencing offset: 0.41 ppm, Outliers: 2 Detail

LACS Plot; CB

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	null	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	null	indirect	0.1013291

Referencing offset: 0.41 ppm, Outliers: 2 Detail

LACS Plot; HA

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	null	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	null	indirect	0.1013291

Referencing offset: -0.05 ppm, Outliers: 2 Detail

LACS Plot; CO

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	null	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	null	indirect	0.1013291

Referencing offset: 0.27 ppm, Outliers: 4 Detail

Protein Blocks Logo

Calculated from 10 models in PDB: 2MMO, Strand ID: A Detail

Release date

2009-05-12

Citation

NMR assignments of oxidised thioredoxin from Plasmodium falciparum
Munte, C., Becker, K., Schirmer, R., Kalbitzer, H.
Biomol. NMR Assign. (2009), 3, 159-161, PubMed 19888680 , DOI 10.1007/s12104-009-9163-7 , Abstract

Related entities 1. Trx, : 1 : 1 : 232 entities Detail

Interaction partners 1. Trx, : 1 interactors Detail

More details for 1 interactors identified by 1 citations

Experiments performed 5 experiments Detail

NMR combined restraints 6 contents Detail

Properties

Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints	combined_16147_2mmo.nef
Input source #2: Coordindates	2mmo.cif
Diamagnetism of the molecular assembly	True (excluding Oxygen atoms)
Whether the assembly has a disulfide bond	True (see coordinates for details)
Whether the assembly has a other bond	None
Whether the assembly contains a cyclic polymer	None
Overall data processing status	Warning

Disulfide bonds

Ptnr_site_1	Ptnr_site_2	Redox_state_prediction_1	Redox_state_prediction_2	Distance (Å)
A:30:CYS:SG	A:33:CYS:SG	unknown	oxidized 9.5%, reduced 90.5%, CA 63.05, CB 34.07 ppm	2.031

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

None

Non-standard residues

None

Sequence alignments

Entity_assembly_ID (NMR): A vs Auth_asym_ID (model): A

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100
SVKIVTSQSEFDSIISQNELVIVDFFAEWCGPCKRIAPFYEECSKTYTKMVFIKVDVDEVSEVTEKENITSMPTFKVYKNGSSVDTLLGANDSALKQLIE
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
SVKIVTSQSEFDSIISQNELVIVDFFAEWCGPCKRIAPFYEECSKTYTKMVFIKVDVDEVSEVTEKENITSMPTFKVYKNGSSVDTLLGANDSALKQLIE

----
KYAA
||||
KYAA

Chain assignments

Entity_assembly_ID (NMR)	Auth_asym_ID (model)	Length	Unmapped	Conflict	Sequence coverage (%)
A	A	104	0	0	100.0

Content subtype: combined_16147_2mmo.nef

#	Content subtype	Saveframe	Status	# of rows (sets)	Experiment type	Sequence coverage (%)
1	Covalent bonds	assembly	OK	1		No information
1	Assigned chemical shifts	assigned_chem_shift_list_1	Warning	1160		100.0 (chain: A, length: 104)
1	Distance restraints	CNS/XPLOR_distance_constraints_2	OK	2666 (1)	noe	100.0 (chain: A, length: 104)
2	Distance restraints	CNS/XPLOR_distance_constraints_3	OK	449 (1)	undefined	86.5 (chain: A, length: 104)
3	Distance restraints	CNS/XPLOR_distance_constraints_4	Warning	26 (1)	undefined	12.5 (chain: A, length: 104)
1	Dihedral angle restraints	CNS/XPLOR_dihedral_6	OK	182 (182)	.	98.1 (chain: A, length: 104)

Assigned chemical shifts

Saveframe: assigned_chem_shift_list_1
- Status: Warning
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 104, Sequence coverage: 100.0%
- Total number of assignments
  - ¹H chemical shifts: 636
  - ¹³C chemical shifts: 423
  - ¹⁵N chemical shifts: 101
- Completeness of assignments
  - Entity_assemble_ID: A
- Redox state of CYS
- Peptide bond of PRO
- Rotameric state of ILE , LEU, and VAL
- Histogram of normalized assigned chemical shifts
- Random coil index and derived parameters (S² and NMR RMSD)
  - Chain_ID: A

Comp_index_ID	Comp_ID	Atom_ID	CS value (ppm)
44	SER	HG	5.78
49	LYS	HZ1	7.83
49	LYS	HZ2	7.83
49	LYS	HZ3	7.83
71	SER	HG	5.48
74	THR	HG1	5.46

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	629	625	99.4
¹³C chemical shifts	483	423	87.6
¹⁵N chemical shifts	110	101	91.8

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	208	206	99.0
¹³C chemical shifts	208	203	97.6
¹⁵N chemical shifts	101	101	100.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	421	419	99.5
¹³C chemical shifts	275	220	80.0
¹⁵N chemical shifts	9	0	0.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	63	63	100.0
¹³C chemical shifts	63	61	96.8

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	52	51	98.1
¹³C chemical shifts	51	0	0.0
¹⁵N chemical shifts	1	0	0.0

Covalent bonds

Saveframe: assembly
- Status: OK

Distance restraints

Saveframe: CNS/XPLOR_distance_constraints_2
- Status: OK
- Experiment type: noe
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 104, Sequence coverage: 100.0%
- Total number of restraints: 2659
- Weight of restraints: 1.0 (2659)
- Potential type of restraints: square-well-parabolic (2659)
- Range of distance target values: 2.0, 7.35 (Å)
- Histogram of distance target values
- Histogram of discrepancy in distance target values
- Distance restraints per residue
  - Chain_ID: A
- Distance restraints on contact map
- Saveframe: CNS/XPLOR_distance_constraints_3
  - Status: OK
  - Experiment type: undefined
  - Sequence coverage of experimental data
    - Entity_assembly_ID: A, Chain length: 104, Sequence coverage: 86.5%
  - Total number of restraints: 445
  - Weight of restraints: 1.0 (445)
  - Potential type of restraints: square-well-parabolic (445)
  - Range of distance target values: 20.0, 20.0 (Å)
  - Distance restraints per residue
    - Chain_ID: A
  - Distance restraints on contact map
  - Saveframe: CNS/XPLOR_distance_constraints_4
    - Status: Warning
    - Experiment type: undefined
    - Sequence coverage of experimental data
      - Entity_assembly_ID: A, Chain length: 104, Sequence coverage: 12.5%
    - Total number of restraints: 26
    - Weight of restraints: 1.0 (26)
    - Potential type of restraints: square-well-parabolic (26)
    - Range of distance target values: 2.94, 20.0 (Å)
    - Histogram of distance target values
    - Distance restraints per residue
      - Chain_ID: A
    - Distance restraints on contact map

Dihedral angle restraints

Saveframe: CNS/XPLOR_dihedral_6
- Status: OK
- Experiment type: .
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 104, Sequence coverage: 98.1%
- Total number of restraints: 182
- Total number of restraints per polymer type: 182
- Weight of restraints: 1.0 (182)
- Potential type of restraints: square-well-parabolic (182)
- Plot of Phi-Psi angle restraints
- Dihedral angle restraints per residue
  - Chain_ID: A

Search

Query history

Resources

Search for primary databases

Search for subsidiary databases

Display

Hits per page

Statistics

Query Changes will take effect after "OK" button is selected.

Maximum hits

Default conjunction operator

Omni-box

Search filter

Sequence search (BLAST)

E-value

Query sequence coverage

Miscellaneous

The number of previewed publications

Completeness of assigned chemical shift

Sequence chart about top aligned regions

Sequence chart about interacting regions

Hit context with highlight

Link destinations for BMRB, PDB and EMDB

Found 1 Document (0.629 seconds)

BMRB: 16147

Sample #1

Sample #2

Sample #3

Chemical shift reference

Chemical shift reference

Chemical shift reference

Chemical shift reference

Related entities 1. Trx, : 1 : 1 : 232 entities Detail

Interaction partners 1. Trx, : 1 interactors Detail

Experiments performed 5 experiments Detail

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

NMR combined restraints 6 contents Detail