Solution structure of XcpT, the main component of the type 2 secretion system of Pseudomonas aeruginosa
MSRPDQAKVT VAKGDIKAIA AALDMYKLDN FAYPSTQQGL EALVKKPTGN PQPKNWNKDG YLKKLPVDPW GNPYQYLAPG TKGPFDLYSL GADGKEGGSD NDADIGNWDN
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 89.5 % (1129 of 1262) | 93.5 % (619 of 662) | 81.4 % (394 of 484) | 100.0 % (116 of 116) |
Backbone | 98.0 % (627 of 640) | 98.6 % (219 of 222) | 96.9 % (308 of 318) | 100.0 % (100 of 100) |
Sidechain | 83.3 % (600 of 720) | 90.9 % (400 of 440) | 69.7 % (184 of 264) | 100.0 % (16 of 16) |
Aromatic | 53.8 % (56 of 104) | 98.1 % (51 of 52) | 4.1 % (2 of 49) | 100.0 % (3 of 3) |
Methyl | 97.9 % (92 of 94) | 100.0 % (47 of 47) | 95.7 % (45 of 47) |
1. XcpT
MSRPDQAKVT VAKGDIKAIA AALDMYKLDN FAYPSTQQGL EALVKKPTGN PQPKNWNKDG YLKKLPVDPW GNPYQYLAPG TKGPFDLYSL GADGKEGGSD NDADIGNWDNSolvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 290 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | XcpT | natural abundance | 1.3 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 150 mM |
Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 290 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | XcpT | [U-15N] | 0.9 mM | |
5 | sodium phosphate | natural abundance | 50 mM | |
6 | sodium chloride | natural abundance | 150 mM |
Solvent system 100% D2O, Pressure 1.0 atm, Temperature 290 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | XcpT | [U-15N] | 0.9 mM | |
8 | sodium phosphate | natural abundance | 50 mM | |
9 | sodium chloride | natural abundance | 150 mM |
Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 290 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | XcpT | [U-13C; U-15N] | 0.9 mM | |
11 | sodium phosphate | natural abundance | 50 mM | |
12 | sodium chloride | natural abundance | 150 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl carbons | 0.0 ppm | external | indirect | 0.2514495 |
1H | water | protons | 4.689 ppm | internal | direct | 1.0 |
15N | [15N] ammonium nitrate | nitrogen | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl carbons | 0.0 ppm | external | indirect | 0.2514495 |
1H | water | protons | 4.689 ppm | internal | direct | 1.0 |
15N | [15N] ammonium nitrate | nitrogen | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl carbons | 0.0 ppm | external | indirect | 0.2514495 |
1H | water | protons | 4.689 ppm | internal | direct | 1.0 |
15N | [15N] ammonium nitrate | nitrogen | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl carbons | 0.0 ppm | external | indirect | 0.2514495 |
1H | water | protons | 4.689 ppm | internal | direct | 1.0 |
15N | [15N] ammonium nitrate | nitrogen | 0.0 ppm | external | indirect | 0.1013291 |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 300 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | XcpT | natural abundance | 1.3 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 150 mM |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 300 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | XcpT | natural abundance | 1.3 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 150 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 290 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | XcpT | [U-15N] | 0.9 mM | |
5 | sodium phosphate | natural abundance | 50 mM | |
6 | sodium chloride | natural abundance | 150 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 290 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | XcpT | [U-13C; U-15N] | 0.9 mM | |
11 | sodium phosphate | natural abundance | 50 mM | |
12 | sodium chloride | natural abundance | 150 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 290 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | XcpT | [U-13C; U-15N] | 0.9 mM | |
11 | sodium phosphate | natural abundance | 50 mM | |
12 | sodium chloride | natural abundance | 150 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 290 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | XcpT | [U-13C; U-15N] | 0.9 mM | |
11 | sodium phosphate | natural abundance | 50 mM | |
12 | sodium chloride | natural abundance | 150 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 290 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | XcpT | [U-13C; U-15N] | 0.9 mM | |
11 | sodium phosphate | natural abundance | 50 mM | |
12 | sodium chloride | natural abundance | 150 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 290 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | XcpT | [U-13C; U-15N] | 0.9 mM | |
11 | sodium phosphate | natural abundance | 50 mM | |
12 | sodium chloride | natural abundance | 150 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 290 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | XcpT | [U-13C; U-15N] | 0.9 mM | |
11 | sodium phosphate | natural abundance | 50 mM | |
12 | sodium chloride | natural abundance | 150 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 290 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | XcpT | [U-13C; U-15N] | 0.9 mM | |
11 | sodium phosphate | natural abundance | 50 mM | |
12 | sodium chloride | natural abundance | 150 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 290 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | XcpT | [U-13C; U-15N] | 0.9 mM | |
11 | sodium phosphate | natural abundance | 50 mM | |
12 | sodium chloride | natural abundance | 150 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 290 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | XcpT | [U-15N] | 0.9 mM | |
5 | sodium phosphate | natural abundance | 50 mM | |
6 | sodium chloride | natural abundance | 150 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 290 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | XcpT | [U-15N] | 0.9 mM | |
5 | sodium phosphate | natural abundance | 50 mM | |
6 | sodium chloride | natural abundance | 150 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 290 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | XcpT | [U-15N] | 0.9 mM | |
5 | sodium phosphate | natural abundance | 50 mM | |
6 | sodium chloride | natural abundance | 150 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 290 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | XcpT | [U-13C; U-15N] | 0.9 mM | |
11 | sodium phosphate | natural abundance | 50 mM | |
12 | sodium chloride | natural abundance | 150 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 290 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | XcpT | [U-13C; U-15N] | 0.9 mM | |
11 | sodium phosphate | natural abundance | 50 mM | |
12 | sodium chloride | natural abundance | 150 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 100% D2O, Pressure 1.0 atm, Temperature 290 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | XcpT | [U-15N] | 0.9 mM | |
8 | sodium phosphate | natural abundance | 50 mM | |
9 | sodium chloride | natural abundance | 150 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1.0 atm, Temperature 290 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | XcpT | [U-15N] | 0.9 mM | |
8 | sodium phosphate | natural abundance | 50 mM | |
9 | sodium chloride | natural abundance | 150 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_16164_2kep.nef |
Input source #2: Coordindates | 2kep.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-40-------50--------60--------70--------80--------90-------100-------110-------120-------130-------1 MSRPDQAKVTVAKGDIKAIAAALDMYKLDNFAYPSTQQGLEALVKKPTGNPQPKNWNKDGYLKKLPVDPWGNPYQYLAPGTKGPFDLYSLGADGKEGGSD |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MSRPDQAKVTVAKGDIKAIAAALDMYKLDNFAYPSTQQGLEALVKKPTGNPQPKNWNKDGYLKKLPVDPWGNPYQYLAPGTKGPFDLYSLGADGKEGGSD --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 40-------- NDADIGNWDN |||||||||| NDADIGNWDN -------110
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 110 | 0 | 0 | 100.0 |
Content subtype: combined_16164_2kep.nef
Assigned chemical shifts
-40-------50--------60--------70--------80--------90-------100-------110-------120-------130-------1 MSRPDQAKVTVAKGDIKAIAAALDMYKLDNFAYPSTQQGLEALVKKPTGNPQPKNWNKDGYLKKLPVDPWGNPYQYLAPGTKGPFDLYSLGADGKEGGSD |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MSRPDQAKVTVAKGDIKAIAAALDMYKLDNFAYPSTQQGLEALVKKPTGNPQPKNWNKDGYLKKLPVDPWGNPYQYLAPGTKGPFDLYSLGADGKEGGSD 40-------- NDADIGNWDN |||||||||| NDADIGNWDN
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
64 | TYR | HH | 9.625 |
99 | TYR | HH | 12.059 |
112 | TYR | HH | 11.656 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 662 | 617 | 93.2 |
13C chemical shifts | 484 | 387 | 80.0 |
15N chemical shifts | 117 | 116 | 99.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 222 | 220 | 99.1 |
13C chemical shifts | 220 | 209 | 95.0 |
15N chemical shifts | 100 | 100 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 440 | 397 | 90.2 |
13C chemical shifts | 264 | 178 | 67.4 |
15N chemical shifts | 17 | 16 | 94.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 49 | 47 | 95.9 |
13C chemical shifts | 49 | 45 | 91.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 52 | 51 | 98.1 |
13C chemical shifts | 49 | 0 | 0.0 |
15N chemical shifts | 3 | 3 | 100.0 |
Distance restraints
-40-------50--------60--------70--------80--------90-------100-------110-------120-------130-------1 MSRPDQAKVTVAKGDIKAIAAALDMYKLDNFAYPSTQQGLEALVKKPTGNPQPKNWNKDGYLKKLPVDPWGNPYQYLAPGTKGPFDLYSLGADGKEGGSD |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MSRPDQAKVTVAKGDIKAIAAALDMYKLDNFAYPSTQQGLEALVKKPTGNPQPKNWNKDGYLKKLPVDPWGNPYQYLAPGTKGPFDLYSLGADGKEGGSD 40-------- NDADIGNWDN |||||||||| NDADIGNWDN
-40-------50--------60--------70--------80--------90-------100-------110-------120-------130-------1 MSRPDQAKVTVAKGDIKAIAAALDMYKLDNFAYPSTQQGLEALVKKPTGNPQPKNWNKDGYLKKLPVDPWGNPYQYLAPGTKGPFDLYSLGADGKEGGSD | | ||| |||||||||||||||||||| ||||||||||| || | || | || | | || | | |||||| ..R.D.AKV.VAKGDIKAIAAALDMYKLDN....STQQGLEALVK..........WN..G.LK.L..DP..N..Q.LA.G..G.FDLYSL.......... -40-------50--------60--------70--------80--------90-------100-------110-------120-------130-------1 40-------- NDADIGNWDN | | | ....I.N.D 40-------
Dihedral angle restraints
-40-------50--------60--------70--------80--------90-------100-------110-------120-------130-------1 MSRPDQAKVTVAKGDIKAIAAALDMYKLDNFAYPSTQQGLEALVKKPTGNPQPKNWNKDGYLKKLPVDPWGNPYQYLAPGTKGPFDLYSLGADGKEGGSD |||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||| MSRPDQAKVTVAKGDIKAIAAALDMYKLDNFAYPSTQQGLEALVKKPTGNPQPKNWNK..YLKKLPVDPWGNPYQYLAPGTKGPFDLYSLGADGKEGGSD 40-------- NDADIGNWDN ||||||||| .DADIGNWDN