The structure of the cataract causing P23T mutant of human gamma-D crystallin
MKHHHHHHQG KITLYEDRGF QGRHYECSSD HTNLQPYLSR CNSARVDSGC WMLYEQPNYS GLQYFLRRGD YADHQQWMGL SDSVRSCRLI PHSGSHRIRL YEREDYRGQM IEFTEDCSCL QDRFRFNEIH SLNVLEGSWV LYELSNYRGR QYLLMPGDYR RYQDWGATNA RVGSLRRVID FS
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 87.2 % (1896 of 2175) | 89.1 % (1017 of 1141) | 82.7 % (690 of 834) | 94.5 % (189 of 200) |
Backbone | 94.8 % (1028 of 1084) | 95.2 % (356 of 374) | 94.0 % (500 of 532) | 96.6 % (172 of 178) |
Sidechain | 81.6 % (1027 of 1259) | 86.2 % (661 of 767) | 74.3 % (349 of 470) | 77.3 % (17 of 22) |
Aromatic | 59.7 % (160 of 268) | 83.6 % (112 of 134) | 33.8 % (44 of 130) | 100.0 % (4 of 4) |
Methyl | 99.2 % (131 of 132) | 100.0 % (66 of 66) | 98.5 % (65 of 66) |
1. p23t
MKHHHHHHQG KITLYEDRGF QGRHYECSSD HTNLQPYLSR CNSARVDSGC WMLYEQPNYS GLQYFLRRGD YADHQQWMGL SDSVRSCRLI PHSGSHRIRL YEREDYRGQM IEFTEDCSCL QDRFRFNEIH SLNVLEGSWV LYELSNYRGR QYLLMPGDYR RYQDWGATNA RVGSLRRVID FSSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | p23t | [U-99% 13C; U-99% 15N] | 0.2-0.8 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | D2O | natural abundance | 5 % | |
5 | H2O | natural abundance | 95 % |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | p23t | [U-99% 13C; U-99% 15N] | 0.2-0.8 mM | |
7 | sodium phosphate | natural abundance | 20 mM | |
8 | DTT | natural abundance | 5 mM | |
9 | D2O | [U-2H] | 5 % | |
10 | H2O | [U-2H] | 5 % | |
11 | Pentaethylene glycol monododecyl ether | natural abundance | 5 % | |
12 | hexanol | natural abundance | 5.2 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | p23t | [U-99% 13C; U-99% 15N] | 0.2-0.8 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | D2O | natural abundance | 5 % | |
5 | H2O | natural abundance | 95 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | p23t | [U-99% 13C; U-99% 15N] | 0.2-0.8 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | D2O | natural abundance | 5 % | |
5 | H2O | natural abundance | 95 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | p23t | [U-99% 13C; U-99% 15N] | 0.2-0.8 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | D2O | natural abundance | 5 % | |
5 | H2O | natural abundance | 95 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | p23t | [U-99% 13C; U-99% 15N] | 0.2-0.8 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | D2O | natural abundance | 5 % | |
5 | H2O | natural abundance | 95 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | p23t | [U-99% 13C; U-99% 15N] | 0.2-0.8 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | D2O | natural abundance | 5 % | |
5 | H2O | natural abundance | 95 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | p23t | [U-99% 13C; U-99% 15N] | 0.2-0.8 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | D2O | natural abundance | 5 % | |
5 | H2O | natural abundance | 95 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | p23t | [U-99% 13C; U-99% 15N] | 0.2-0.8 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | D2O | natural abundance | 5 % | |
5 | H2O | natural abundance | 95 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | p23t | [U-99% 13C; U-99% 15N] | 0.2-0.8 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | D2O | natural abundance | 5 % | |
5 | H2O | natural abundance | 95 % |
Bruker Avance - 800 MHz
State anisotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | p23t | [U-99% 13C; U-99% 15N] | 0.2-0.8 mM | |
7 | sodium phosphate | natural abundance | 20 mM | |
8 | DTT | natural abundance | 5 mM | |
9 | D2O | [U-2H] | 5 % | |
10 | H2O | [U-2H] | 5 % | |
11 | Pentaethylene glycol monododecyl ether | natural abundance | 5 % | |
12 | hexanol | natural abundance | 5.2 % |
Bruker Avance - 800 MHz
State anisotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | p23t | [U-99% 13C; U-99% 15N] | 0.2-0.8 mM | |
7 | sodium phosphate | natural abundance | 20 mM | |
8 | DTT | natural abundance | 5 mM | |
9 | D2O | [U-2H] | 5 % | |
10 | H2O | [U-2H] | 5 % | |
11 | Pentaethylene glycol monododecyl ether | natural abundance | 5 % | |
12 | hexanol | natural abundance | 5.2 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_16173_2kfb.nef |
Input source #2: Coordindates | 2kfb.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
----------------10--------20--------30--------40--------50--------60--------70--------80--------90-- MKHHHHHHQGKITLYEDRGFQGRHYECSSDHTNLQPYLSRCNSARVDSGCWMLYEQPNYSGLQYFLRRGDYADHQQWMGLSDSVRSCRLIPHSGSHRIRL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MKHHHHHHQGKITLYEDRGFQGRHYECSSDHTNLQPYLSRCNSARVDSGCWMLYEQPNYSGLQYFLRRGDYADHQQWMGLSDSVRSCRLIPHSGSHRIRL --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -----100-------110-------120-------130-------140-------150-------160-------170---- YEREDYRGQMIEFTEDCSCLQDRFRFNEIHSLNVLEGSWVLYELSNYRGRQYLLMPGDYRRYQDWGATNARVGSLRRVIDFS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| YEREDYRGQMIEFTEDCSCLQDRFRFNEIHSLNVLEGSWVLYELSNYRGRQYLLMPGDYRRYQDWGATNARVGSLRRVIDFS -------110-------120-------130-------140-------150-------160-------170-------180--
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 182 | 0 | 0 | 100.0 |
Content subtype: combined_16173_2kfb.nef
Assigned chemical shifts
----------------10--------20--------30--------40--------50--------60--------70--------80--------90-- MKHHHHHHQGKITLYEDRGFQGRHYECSSDHTNLQPYLSRCNSARVDSGCWMLYEQPNYSGLQYFLRRGDYADHQQWMGLSDSVRSCRLIPHSGSHRIRL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ........QGKITLYEDRGFQGRHYECSSDHTNLQPYLSRCNSARVDSGCWMLYEQPNYSGLQYFLRRGDYADHQQWMGLSDSVRSCRLIPHSGSHRIRL -----100-------110-------120-------130-------140-------150-------160-------170---- YEREDYRGQMIEFTEDCSCLQDRFRFNEIHSLNVLEGSWVLYELSNYRGRQYLLMPGDYRRYQDWGATNARVGSLRRVIDFS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| YEREDYRGQMIEFTEDCSCLQDRFRFNEIHSLNVLEGSWVLYELSNYRGRQYLLMPGDYRRYQDWGATNARVGSLRRVIDFS
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
33 | CYS | HG | 1.73 |
122 | HIS | NE2 | 174.511 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 1141 | 1008 | 88.3 |
13C chemical shifts | 834 | 678 | 81.3 |
15N chemical shifts | 221 | 190 | 86.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 374 | 358 | 95.7 |
13C chemical shifts | 364 | 343 | 94.2 |
15N chemical shifts | 178 | 170 | 95.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 767 | 650 | 84.7 |
13C chemical shifts | 470 | 335 | 71.3 |
15N chemical shifts | 43 | 20 | 46.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 71 | 70 | 98.6 |
13C chemical shifts | 71 | 68 | 95.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 134 | 110 | 82.1 |
13C chemical shifts | 130 | 40 | 30.8 |
15N chemical shifts | 4 | 4 | 100.0 |
Distance restraints
----------------10--------20--------30--------40--------50--------60--------70--------80--------90-- MKHHHHHHQGKITLYEDRGFQGRHYECSSDHTNLQPYLSRCNSARVDSGCWMLYEQPNYSGLQYFLRRGDYADHQQWMGLSDSVRSCRLIPHSGSHRIRL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ........QGKITLYEDRGFQGRHYECSSDHTNLQPYLSRCNSARVDSGCWMLYEQPNYSGLQYFLRRGDYADHQQWMGLSDSVRSCRLIPHSGSHRIRL -----100-------110-------120-------130-------140-------150-------160-------170---- YEREDYRGQMIEFTEDCSCLQDRFRFNEIHSLNVLEGSWVLYELSNYRGRQYLLMPGDYRRYQDWGATNARVGSLRRVIDFS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| YEREDYRGQMIEFTEDCSCLQDRFRFNEIHSLNVLEGSWVLYELSNYRGRQYLLMPGDYRRYQDWGATNARVGSLRRVIDFS
Dihedral angle restraints
----------------10--------20--------30--------40--------50--------60--------70--------80--------90-- MKHHHHHHQGKITLYEDRGFQGRHYECSSDHTNLQPYLSRCNSARVDSGCWMLYEQPNYSGLQYFLRRGDYADHQQWMGLSDSVRSCRLIPHSGSHRIRL |||||| ||||||||| || ||| |||||||||||||||| |||||||||| |||||| ||| |||||| ||||||| .........GKITLY.......RHYECSSDH..LQ.YLS...SARVDSGCWMLYEQPN...LQYFLRRGDY.DHQQWM.LSD...SCRLIP..GSHRIRL ----------------10--------20--------30--------40--------50--------60--------70--------80--------90-- -----100-------110-------120-------130-------140-------150-------160-------170---- YEREDYRGQMIEFTEDCSCLQDRFRFNEIHSLNVLEGSWVLYELSNYRGRQYLLMPGDYRRYQDWGATNARVGSLRRVIDFS | |||||| ||||||| |||||||||| |||||| |||||| |||||||| ||||||| Y.......QMIEFT....CLQDRFR.NEIHSLNVLE.SWVLYE......RQYLLM.....RYQDWGAT.....SLRRVID -----100-------110-------120-------130-------140-------150-------160-------170--
RDC restraints
----------------10--------20--------30--------40--------50--------60--------70--------80--------90-- MKHHHHHHQGKITLYEDRGFQGRHYECSSDHTNLQPYLSRCNSARVDSGCWMLYEQPNYSGLQYFLRRGDYADHQQWMGLSDSVRSCRLIPHSGSHRIRL |||||||||||| |||||||||||||||||||||||||| |||||||||||||||||||||||| ||||||||||||||||||| |||||| .........GKITLYEDRGFQ.RHYECSSDHTNLQPYLSRCNSARVDS.CWMLYEQPNYSGLQYFLRRGDYAD.QQWMGLSDSVRSCRLIPHS.SHRIRL ----------------10--------20--------30--------40--------50--------60--------70--------80--------90-- -----100-------110-------120-------130-------140-------150-------160-------170---- YEREDYRGQMIEFTEDCSCLQDRFRFNEIHSLNVLEGSWVLYELSNYRGRQYLLMPGDYRRYQDWGATNARVGSLRRVIDFS ||||||| ||||||||||||||||||||| |||||| ||||||||||||||||| |||||||||||||||||||||||| YEREDYR.QMIEFTEDCSCLQDRFRFNEI.SLNVLE.SWVLYELSNYRGRQYLL.PGDYRRYQDWGATNARVGSLRRVI -----100-------110-------120-------130-------140-------150-------160-------170-