Structure of the C-terminal domain of EHD1 in complex with FNYESTNPFTAK
GPLGSDDVEW VVGKDKPTYD EIFYTLSPVN GKITGANAKK EMVKSKLPNT VLGKIWKLAD VDKDGLLDDE EFALANHLIK VKLEGHELPA DLPPHLVPPS KRRHE
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 81.9 % (1130 of 1379) | 92.5 % (666 of 720) | 68.4 % (373 of 545) | 79.8 % (91 of 114) |
Backbone | 73.0 % (498 of 682) | 90.5 % (210 of 232) | 58.9 % (202 of 343) | 80.4 % (86 of 107) |
Sidechain | 89.8 % (724 of 806) | 93.4 % (456 of 488) | 84.6 % (263 of 311) | 71.4 % (5 of 7) |
Aromatic | 78.8 % (82 of 104) | 90.4 % (47 of 52) | 68.0 % (34 of 50) | 50.0 % (1 of 2) |
Methyl | 91.5 % (119 of 130) | 93.8 % (61 of 65) | 89.2 % (58 of 65) |
1. EH domain of EHD1
GPLGSDDVEW VVGKDKPTYD EIFYTLSPVN GKITGANAKK EMVKSKLPNT VLGKIWKLAD VDKDGLLDDE EFALANHLIK VKLEGHELPA DLPPHLVPPS KRRHE2. Rab11-FIP2 DPF peptide
FNYESTDPFT AKSolvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.0, Details 20mM Tris, 100Kcl, 2mM Cacl2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | EH domain of EHD1 | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | Rab11-FIP2 NPF peptide | natural abundance | 3 mM | |
3 | H20 | natural abundance | 90 % | |
4 | D20 | natural abundance | 10 % |
Varian VXRS - 800 MHz with cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.0, Details 20mM Tris, 100Kcl, 2mM Cacl2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | EH domain of EHD1 | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | Rab11-FIP2 NPF peptide | natural abundance | 3 mM | |
3 | H20 | natural abundance | 90 % | |
4 | D20 | natural abundance | 10 % |
Varian VXRS - 800 MHz with cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.0, Details 20mM Tris, 100Kcl, 2mM Cacl2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | EH domain of EHD1 | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | Rab11-FIP2 NPF peptide | natural abundance | 3 mM | |
3 | H20 | natural abundance | 90 % | |
4 | D20 | natural abundance | 10 % |
Varian VXRS - 800 MHz with cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.0, Details 20mM Tris, 100Kcl, 2mM Cacl2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | EH domain of EHD1 | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | Rab11-FIP2 NPF peptide | natural abundance | 3 mM | |
3 | H20 | natural abundance | 90 % | |
4 | D20 | natural abundance | 10 % |
Varian VXRS - 800 MHz with cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.0, Details 20mM Tris, 100Kcl, 2mM Cacl2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | EH domain of EHD1 | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | Rab11-FIP2 NPF peptide | natural abundance | 3 mM | |
3 | H20 | natural abundance | 90 % | |
4 | D20 | natural abundance | 10 % |
Varian VXRS - 800 MHz with cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.0, Details 20mM Tris, 100Kcl, 2mM Cacl2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | EH domain of EHD1 | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | Rab11-FIP2 NPF peptide | natural abundance | 3 mM | |
3 | H20 | natural abundance | 90 % | |
4 | D20 | natural abundance | 10 % |
Varian VXRS - 800 MHz with cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.0, Details 20mM Tris, 100Kcl, 2mM Cacl2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | EH domain of EHD1 | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | Rab11-FIP2 NPF peptide | natural abundance | 3 mM | |
3 | H20 | natural abundance | 90 % | |
4 | D20 | natural abundance | 10 % |
Varian VXRS - 800 MHz with cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.0, Details 20mM Tris, 100Kcl, 2mM Cacl2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | EH domain of EHD1 | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | Rab11-FIP2 NPF peptide | natural abundance | 3 mM | |
3 | H20 | natural abundance | 90 % | |
4 | D20 | natural abundance | 10 % |
Varian VXRS - 800 MHz with cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.0, Details 20mM Tris, 100Kcl, 2mM Cacl2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | EH domain of EHD1 | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | Rab11-FIP2 NPF peptide | natural abundance | 3 mM | |
3 | H20 | natural abundance | 90 % | |
4 | D20 | natural abundance | 10 % |
Varian INOVA - 600 MHz with cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.0, Details 20mM Tris, 100Kcl, 2mM Cacl2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | EH domain of EHD1 | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | Rab11-FIP2 NPF peptide | natural abundance | 3 mM | |
3 | H20 | natural abundance | 90 % | |
4 | D20 | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_16180_2kfg.nef |
Input source #2: Coordindates | 2kfg.cif |
Diamagnetism of the molecular assembly | False (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | True (see coodinates for details) |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Ã…) |
---|---|---|---|---|
1:66:LEU:O | 3:1:CA:CA | unknown | unknown | n/a |
1:71:GLU:OE2 | 3:1:CA:CA | unknown | unknown | n/a |
1:71:GLU:OE1 | 3:1:CA:CA | unknown | unknown | n/a |
Non-standard residues
Chain_ID | Seq_ID | Comp_ID | Chem_comp_name | Experimental evidences |
---|---|---|---|---|
C | 1 | CA | CALCIUM ION | None |
Sequence alignments
----40--------50--------60--------70--------80--------90-------100-------110-------120-------130---- GPLGSDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLVPPS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GPLGSDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLVPPS --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ----- KRRHE ||||| KRRHE -----
-----150---- FNYESTDPFTAK |||||||||||| FNYESTDPFTAK --------10--
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 105 | 0 | 0 | 100.0 |
B | B | 12 | 0 | 0 | 100.0 |
Content subtype: combined_16180_2kfg.nef
Assigned chemical shifts
----40--------50--------60--------70--------80--------90-------100-------110-------120-------130---- GPLGSDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLVPPS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ......DVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLVPPS ----- KRRHE ||||| KRRHE
-----150---- FNYESTDPFTAK |||||||||||| FNYESTDPFTAK
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
59 | THR | HG1 | 6.02 |
68 | THR | HG1 | 5.4 |
136 | ARG | HH11 | 6.4 |
136 | ARG | HH12 | 7.16 |
136 | ARG | HH21 | 6.327 |
136 | ARG | HH22 | 7.16 |
137 | ARG | HH11 | 6.4 |
137 | ARG | HH12 | 7.16 |
137 | ARG | HH21 | 6.4 |
137 | ARG | HH22 | 7.16 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 646 | 616 | 95.4 |
13C chemical shifts | 487 | 365 | 74.9 |
15N chemical shifts | 104 | 91 | 87.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 209 | 196 | 93.8 |
13C chemical shifts | 210 | 99 | 47.1 |
15N chemical shifts | 96 | 86 | 89.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 437 | 420 | 96.1 |
13C chemical shifts | 277 | 266 | 96.0 |
15N chemical shifts | 8 | 5 | 62.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 63 | 61 | 96.8 |
13C chemical shifts | 63 | 61 | 96.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 38 | 38 | 100.0 |
13C chemical shifts | 36 | 34 | 94.4 |
15N chemical shifts | 2 | 1 | 50.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 74 | 63 | 85.1 |
13C chemical shifts | 58 | 0 | 0.0 |
15N chemical shifts | 12 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 23 | 21 | 91.3 |
13C chemical shifts | 24 | 0 | 0.0 |
15N chemical shifts | 11 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 51 | 42 | 82.4 |
13C chemical shifts | 34 | 0 | 0.0 |
15N chemical shifts | 1 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 3 | 3 | 100.0 |
13C chemical shifts | 3 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 14 | 9 | 64.3 |
13C chemical shifts | 14 | 0 | 0.0 |
Covalent bonds
Distance restraints
----40--------50--------60--------70--------80--------90-------100-------110-------120-------130---- GPLGSDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLVPPS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ......DVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLVPPS ----- KRRHE ||||| KRRHE
-----150---- FNYESTDPFTAK |||||||||||| FNYESTDPFTAK