Structure of the C-terminal domain of EHD1 with FNYESTGPFTAK
GPLGSDDVEW VVGKDKPTYD EIFYTLSPVN GKITGANAKK EMVKSKLPNT VLGKIWKLAD VDKDGLLDDE EFALANHLIK VKLEGHELPA DLPPHLVPPS KRRHE
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 83.5 % (1150 of 1377) | 92.6 % (666 of 719) | 71.9 % (391 of 544) | 81.6 % (93 of 114) |
Backbone | 76.8 % (524 of 682) | 92.3 % (215 of 233) | 64.6 % (221 of 342) | 82.2 % (88 of 107) |
Sidechain | 89.7 % (720 of 803) | 92.8 % (451 of 486) | 85.2 % (264 of 310) | 71.4 % (5 of 7) |
Aromatic | 77.9 % (81 of 104) | 88.5 % (46 of 52) | 68.0 % (34 of 50) | 50.0 % (1 of 2) |
Methyl | 91.5 % (119 of 130) | 93.8 % (61 of 65) | 89.2 % (58 of 65) |
1. EH domain of EHD1
GPLGSDDVEW VVGKDKPTYD EIFYTLSPVN GKITGANAKK EMVKSKLPNT VLGKIWKLAD VDKDGLLDDE EFALANHLIK VKLEGHELPA DLPPHLVPPS KRRHE2. Rab11-FIP2 GPF peptide
FNYESTGPFT AKSolvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, Details 20mM Tris, 100Kcl, 2mM Cacl2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | EH domain of EHD1 | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | Rab11-FIP2 GPF peptide | natural abundance | 3 mM | |
3 | H20 | natural abundance | 90 % | |
4 | D20 | natural abundance | 10 % |
Varian INOVA - 600 MHz with cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, Details 20mM Tris, 100Kcl, 2mM Cacl2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | EH domain of EHD1 | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | Rab11-FIP2 GPF peptide | natural abundance | 3 mM | |
3 | H20 | natural abundance | 90 % | |
4 | D20 | natural abundance | 10 % |
Varian INOVA - 600 MHz with cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, Details 20mM Tris, 100Kcl, 2mM Cacl2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | EH domain of EHD1 | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | Rab11-FIP2 GPF peptide | natural abundance | 3 mM | |
3 | H20 | natural abundance | 90 % | |
4 | D20 | natural abundance | 10 % |
Varian INOVA - 600 MHz with cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, Details 20mM Tris, 100Kcl, 2mM Cacl2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | EH domain of EHD1 | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | Rab11-FIP2 GPF peptide | natural abundance | 3 mM | |
3 | H20 | natural abundance | 90 % | |
4 | D20 | natural abundance | 10 % |
Varian INOVA - 600 MHz with cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, Details 20mM Tris, 100Kcl, 2mM Cacl2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | EH domain of EHD1 | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | Rab11-FIP2 GPF peptide | natural abundance | 3 mM | |
3 | H20 | natural abundance | 90 % | |
4 | D20 | natural abundance | 10 % |
Varian INOVA - 600 MHz with cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, Details 20mM Tris, 100Kcl, 2mM Cacl2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | EH domain of EHD1 | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | Rab11-FIP2 GPF peptide | natural abundance | 3 mM | |
3 | H20 | natural abundance | 90 % | |
4 | D20 | natural abundance | 10 % |
Varian INOVA - 600 MHz with cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, Details 20mM Tris, 100Kcl, 2mM Cacl2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | EH domain of EHD1 | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | Rab11-FIP2 GPF peptide | natural abundance | 3 mM | |
3 | H20 | natural abundance | 90 % | |
4 | D20 | natural abundance | 10 % |
Varian INOVA - 600 MHz with cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, Details 20mM Tris, 100Kcl, 2mM Cacl2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | EH domain of EHD1 | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | Rab11-FIP2 GPF peptide | natural abundance | 3 mM | |
3 | H20 | natural abundance | 90 % | |
4 | D20 | natural abundance | 10 % |
Varian INOVA - 600 MHz with cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, Details 20mM Tris, 100Kcl, 2mM Cacl2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | EH domain of EHD1 | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | Rab11-FIP2 GPF peptide | natural abundance | 3 mM | |
3 | H20 | natural abundance | 90 % | |
4 | D20 | natural abundance | 10 % |
Varian INOVA - 600 MHz with cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, Details 20mM Tris, 100Kcl, 2mM Cacl2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | EH domain of EHD1 | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | Rab11-FIP2 GPF peptide | natural abundance | 3 mM | |
3 | H20 | natural abundance | 90 % | |
4 | D20 | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_16181_2kfh.nef |
Input source #2: Coordindates | 2kfh.cif |
Diamagnetism of the molecular assembly | False (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | True (see coodinates for details) |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Ã…) |
---|---|---|---|---|
1:66:LEU:O | 3:1:CA:CA | unknown | unknown | n/a |
1:71:GLU:OE2 | 3:1:CA:CA | unknown | unknown | n/a |
1:60:ASP:OD1 | 3:1:CA:CA | unknown | unknown | n/a |
1:71:GLU:OE1 | 3:1:CA:CA | unknown | unknown | n/a |
Non-standard residues
Chain_ID | Seq_ID | Comp_ID | Chem_comp_name | Experimental evidences |
---|---|---|---|---|
C | 1 | CA | CALCIUM ION | None |
Sequence alignments
----40--------50--------60--------70--------80--------90-------100-------110-------120-------130---- GPLGSDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLVPPS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GPLGSDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLVPPS --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ----- KRRHE ||||| KRRHE -----
-----150---- FNYESTGPFTAK |||||||||||| FNYESTGPFTAK --------10--
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 105 | 0 | 0 | 100.0 |
B | B | 12 | 0 | 0 | 100.0 |
Content subtype: combined_16181_2kfh.nef
Assigned chemical shifts
----40--------50--------60--------70--------80--------90-------100-------110-------120-------130---- GPLGSDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLVPPS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ......DVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLVPPS ----- KRRHE ||||| KRRHE
-----150---- FNYESTGPFTAK ||||||||||| .NYESTGPFTAK
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
59 | THR | HG1 | 6.04 |
68 | THR | HG1 | 5.4 |
136 | ARG | HH11 | 6.4 |
136 | ARG | HH12 | 7.16 |
136 | ARG | HH21 | 6.4 |
136 | ARG | HH22 | 7.16 |
137 | ARG | HH11 | 6.4 |
137 | ARG | HH12 | 7.16 |
137 | ARG | HH21 | 6.4 |
137 | ARG | HH22 | 7.16 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 646 | 616 | 95.4 |
13C chemical shifts | 487 | 365 | 74.9 |
15N chemical shifts | 104 | 91 | 87.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 209 | 196 | 93.8 |
13C chemical shifts | 210 | 99 | 47.1 |
15N chemical shifts | 96 | 86 | 89.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 437 | 420 | 96.1 |
13C chemical shifts | 277 | 266 | 96.0 |
15N chemical shifts | 8 | 5 | 62.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 63 | 61 | 96.8 |
13C chemical shifts | 63 | 61 | 96.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 38 | 38 | 100.0 |
13C chemical shifts | 36 | 34 | 94.4 |
15N chemical shifts | 2 | 1 | 50.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 73 | 59 | 80.8 |
13C chemical shifts | 57 | 0 | 0.0 |
15N chemical shifts | 12 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 24 | 22 | 91.7 |
13C chemical shifts | 24 | 0 | 0.0 |
15N chemical shifts | 11 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 49 | 37 | 75.5 |
13C chemical shifts | 33 | 0 | 0.0 |
15N chemical shifts | 1 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 3 | 3 | 100.0 |
13C chemical shifts | 3 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 14 | 8 | 57.1 |
13C chemical shifts | 14 | 0 | 0.0 |
Covalent bonds
Distance restraints
----40--------50--------60--------70--------80--------90-------100-------110-------120-------130---- GPLGSDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLVPPS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ......DVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLVPPS ----- KRRHE ||||| KRRHE
-----150---- FNYESTGPFTAK ||||||||||| .NYESTGPFTAK