Structure of the third qRRM domain of hnRNP F in complex with a AGGGAU G-tract RNA
GDSEFTVQST TGHCVHMRGL PYKATENDIY NFFSPLNPVR VHIEIGPDGR VTGEADVEFA THEEAVAAMS KDRANMQHRY IELFLNSTTG ASNGAYSSQV MQGMG
Polymer type: polyribonucleotide polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 81.4 % (1014 of 1245) | 93.0 % (596 of 641) | 63.2 % (309 of 489) | 94.8 % (109 of 115) |
Backbone | 79.8 % (549 of 688) | 97.2 % (245 of 252) | 60.6 % (203 of 335) | 100.0 % (101 of 101) |
Sidechain | 85.0 % (554 of 652) | 90.2 % (351 of 389) | 78.3 % (195 of 249) | 57.1 % (8 of 14) |
Aromatic | 66.4 % (85 of 128) | 92.2 % (59 of 64) | 43.3 % (26 of 60) | 0.0 % (0 of 4) |
Methyl | 96.9 % (95 of 98) | 98.0 % (48 of 49) | 95.9 % (47 of 49) |
1. AGGGAU G-tract RNA
AGGGAU2. third qRRM of hnRNP F
GDSEFTVQST TGHCVHMRGL PYKATENDIY NFFSPLNPVR VHIEIGPDGR VTGEADVEFA THEEAVAAMS KDRANMQHRY IELFLNSTTG ASNGAYSSQV MQGMGSolvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | natural abundance | 1.0 ~ 1.5 mM | |
2 | entity_2 | [U-13C; U-15N] | 1.0 ~ 1.5 mM | |
3 | NaH2PO4 | natural abundance | 20 mM | |
4 | NaCl | natural abundance | 50 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.0 ppm | internal | indirect | 0.0 |
1H | water | protons | 4.7 ppm | internal | direct | 1.0 |
15N | water | protons | 4.7 ppm | internal | indirect | 0.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.0 ppm | internal | indirect | 0.0 |
1H | water | protons | 4.7 ppm | internal | direct | 1.0 |
15N | water | protons | 4.7 ppm | internal | indirect | 0.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.0 ppm | internal | indirect | 0.0 |
1H | water | protons | 4.7 ppm | internal | direct | 1.0 |
15N | water | protons | 4.7 ppm | internal | indirect | 0.0 |
Bruker Avance - 700 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | natural abundance | 1.0 ~ 1.5 mM | |
2 | entity_2 | [U-13C; U-15N] | 1.0 ~ 1.5 mM | |
3 | NaH2PO4 | natural abundance | 20 mM | |
4 | NaCl | natural abundance | 50 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | natural abundance | 1.0 ~ 1.5 mM | |
2 | entity_2 | [U-13C; U-15N] | 1.0 ~ 1.5 mM | |
3 | NaH2PO4 | natural abundance | 20 mM | |
4 | NaCl | natural abundance | 50 mM |
Bruker Avance - 900 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | natural abundance | 1.0 ~ 1.5 mM | |
2 | entity_2 | [U-13C; U-15N] | 1.0 ~ 1.5 mM | |
3 | NaH2PO4 | natural abundance | 20 mM | |
4 | NaCl | natural abundance | 50 mM |
Bruker Avance - 900 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | natural abundance | 1.0 ~ 1.5 mM | |
2 | entity_2 | [U-13C; U-15N] | 1.0 ~ 1.5 mM | |
3 | NaH2PO4 | natural abundance | 20 mM | |
4 | NaCl | natural abundance | 50 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_16194_2kg1.nef |
Input source #2: Coordindates | 2kg1.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-----250-------260-------270-------280-------290-------300-------310-------320-------330-------340-- MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSGDSEFTVQSTTGHCVHMRGLPYKATENDIYNFFSPLNPVRVHIEIGPDGRVTGEADVEFATHEEAV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSGDSEFTVQSTTGHCVHMRGLPYKATENDIYNFFSPLNPVRVHIEIGPDGRVTGEADVEFATHEEAV --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -----350-------360-------370-------380- AAMSKDRANMQHRYIELFLNSTTGASNGAYSSQVMQGMG ||||||||||||||||||||||||||||||||||||||| AAMSKDRANMQHRYIELFLNSTTGASNGAYSSQVMQGMG -------110-------120-------130---------
------ AGGGAU |||||| AGGGAU
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 139 | 0 | 0 | 100.0 |
B | B | 6 | 0 | 0 | 100.0 |
Content subtype: combined_16194_2kg1.nef
Assigned chemical shifts
-----250-------260-------270-------280-------290-------300-------310-------320-------330-------340-- MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSGDSEFTVQSTTGHCVHMRGLPYKATENDIYNFFSPLNPVRVHIEIGPDGRVTGEADVEFATHEEAV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..................................GDSEFTVQSTTGHCVHMRGLPYKATENDIYNFFSPLNPVRVHIEIGPDGRVTGEADVEFATHEEAV -----350-------360-------370-------380- AAMSKDRANMQHRYIELFLNSTTGASNGAYSSQVMQGMG ||||||||||||||||||||||||||||||||||||||| AAMSKDRANMQHRYIELFLNSTTGASNGAYSSQVMQGMG
------ AGGGAU |||||| AGGGAU
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 771 | 550 | 71.3 |
15N chemical shifts | 153 | 114 | 74.5 |
13C chemical shifts | 581 | 283 | 48.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 290 | 211 | 72.8 |
15N chemical shifts | 134 | 101 | 75.4 |
13C chemical shifts | 278 | 89 | 32.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 481 | 339 | 70.5 |
15N chemical shifts | 19 | 13 | 68.4 |
13C chemical shifts | 303 | 194 | 64.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 64 | 51 | 79.7 |
13C chemical shifts | 64 | 50 | 78.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 65 | 47 | 72.3 |
13C chemical shifts | 65 | 26 | 40.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 49 | 48 | 98.0 |
15N chemical shifts | 4 | 0 | 0.0 |
13C chemical shifts | 39 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 36 | 36 | 100.0 |
13C chemical shifts | 30 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 13 | 12 | 92.3 |
15N chemical shifts | 4 | 0 | 0.0 |
13C chemical shifts | 9 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 7 | 7 | 100.0 |
13C chemical shifts | 7 | 0 | 0.0 |
Distance restraints
-----250-------260-------270-------280-------290-------300-------310-------320-------330-------340-- MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSGDSEFTVQSTTGHCVHMRGLPYKATENDIYNFFSPLNPVRVHIEIGPDGRVTGEADVEFATHEEAV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..................................GDSEFTVQSTTGHCVHMRGLPYKATENDIYNFFSPLNPVRVHIEIGPDGRVTGEADVEFATHEEAV -----250-------260-------270-------280-------290-------300-------310-------320-------330-------340-- -----350-------360-------370-------380- AAMSKDRANMQHRYIELFLNSTTGASNGAYSSQVMQGMG ||||||||||||||||||||||||||||||||||| AAMSKDRANMQHRYIELFLNSTTGASNGAYSSQVM -----350-------360-------370-------
------ AGGGAU |||||| AGGGAU