Bruno RRM3+
AAGLPQFGSA SALSTSPLAS VALSAAAAAA AGKQIEGPEG CNLFIYHLPQ EFTDTDLAST FLPFGNVISA KVFIDKQTSL SKCFGFVSFD NPDSAQVAIK AMNGFQVGTK RLKVQLKK
ID | Type | Value order | Atom ID 1 | Atom ID 2 |
---|---|---|---|---|
1 | disulfide | sing | 1:CYS41:SG | 1:CYS83:SG |
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 91.8 % (1215 of 1323) | 96.2 % (652 of 678) | 84.7 % (442 of 522) | 98.4 % (121 of 123) |
Backbone | 97.6 % (679 of 696) | 97.9 % (234 of 239) | 97.1 % (335 of 345) | 98.2 % (110 of 112) |
Sidechain | 87.4 % (643 of 736) | 95.2 % (418 of 439) | 74.8 % (214 of 286) | 100.0 % (11 of 11) |
Aromatic | 51.8 % (58 of 112) | 98.2 % (55 of 56) | 5.4 % (3 of 56) | |
Methyl | 94.3 % (132 of 140) | 94.3 % (66 of 70) | 94.3 % (66 of 70) |
1. Bruno RRM3+
AAGLPQFGSA SALSTSPLAS VALSAAAAAA AGKQIEGPEG CNLFIYHLPQ EFTDTDLAST FLPFGNVISA KVFIDKQTSL SKCFGFVSFD NPDSAQVAIK AMNGFQVGTK RLKVQLKKSolvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 1,0 mM Bruno RRM3+ | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | potassium phosphate | natural abundance | 1 mM | |
3 | sodium chloride | natural abundance | 300.0 ~ 400.0 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Varian Inova - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 1,0 mM Bruno RRM3+ | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | potassium phosphate | natural abundance | 1 mM | |
3 | sodium chloride | natural abundance | 300.0 ~ 400.0 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian Inova - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 1,0 mM Bruno RRM3+ | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | potassium phosphate | natural abundance | 1 mM | |
3 | sodium chloride | natural abundance | 300.0 ~ 400.0 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian Inova - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 1,0 mM Bruno RRM3+ | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | potassium phosphate | natural abundance | 1 mM | |
3 | sodium chloride | natural abundance | 300.0 ~ 400.0 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_16236_2khc.nef |
Input source #2: Coordindates | 2khc.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
480-----490-------500-------510-------520-------530-------540-------550-------560-------570-------58 AAGLPQFGSASALSTSPLASVALSAAAAAAAGKQIEGPEGCNLFIYHLPQEFTDTDLASTFLPFGNVISAKVFIDKQTSLSKCFGFVSFDNPDSAQVAIK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| AAGLPQFGSASALSTSPLASVALSAAAAAAAGKQIEGPEGCNLFIYHLPQEFTDTDLASTFLPFGNVISAKVFIDKQTSLSKCFGFVSFDNPDSAQVAIK --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 0-------590------- AMNGFQVGTKRLKVQLKK |||||||||||||||||| AMNGFQVGTKRLKVQLKK -------110--------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 118 | 0 | 0 | 100.0 |
Content subtype: combined_16236_2khc.nef
Assigned chemical shifts
480-----490-------500-------510-------520-------530-------540-------550-------560-------570-------58 AAGLPQFGSASALSTSPLASVALSAAAAAAAGKQIEGPEGCNLFIYHLPQEFTDTDLASTFLPFGNVISAKVFIDKQTSLSKCFGFVSFDNPDSAQVAIK |||||||||||||||| ||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| AAGLPQFGSASALSTS....VAL.AAAAAAAGKQIEGPEGCNLFIYHLPQEFTDTDLASTFLPFGNVISAKVFIDKQTSLSKCFGFVSFDNPDSAQVAIK 0-------590------- AMNGFQVGTKRLKVQLKK |||||||||||||||||| AMNGFQVGTKRLKVQLKK
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
485 | GLN | CD | 180.0 |
513 | GLN | CD | 179.1 |
521 | ASN | CG | 176.2 |
526 | HIS | HD1 | 7.44 |
526 | HIS | HE2 | 7.67 |
545 | ASN | CG | 174.9 |
557 | THR | HG1 | 4.36 |
570 | ASN | CG | 176.5 |
582 | ASN | CG | 176.1 |
590 | ARG | HH11 | 6.98 |
590 | ARG | HH12 | 6.98 |
590 | ARG | HH21 | 7.04 |
590 | ARG | HH22 | 7.04 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 678 | 643 | 94.8 |
13C chemical shifts | 522 | 426 | 81.6 |
15N chemical shifts | 124 | 117 | 94.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 239 | 228 | 95.4 |
13C chemical shifts | 236 | 221 | 93.6 |
15N chemical shifts | 112 | 106 | 94.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 439 | 415 | 94.5 |
13C chemical shifts | 286 | 205 | 71.7 |
15N chemical shifts | 12 | 11 | 91.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 71 | 66 | 93.0 |
13C chemical shifts | 71 | 65 | 91.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 56 | 55 | 98.2 |
13C chemical shifts | 56 | 0 | 0.0 |
Distance restraints
480-----490-------500-------510-------520-------530-------540-------550-------560-------570-------58 AAGLPQFGSASALSTSPLASVALSAAAAAAAGKQIEGPEGCNLFIYHLPQEFTDTDLASTFLPFGNVISAKVFIDKQTSLSKCFGFVSFDNPDSAQVAIK |||||||| |||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .AGLPQFGS...LSTS...............GKQIEGPEGCNLFIYHLPQEFTDTDLASTFLPFGNVISAKVFIDKQTSLSKCFGFVSFDNPDSAQVAIK 0-------590------- AMNGFQVGTKRLKVQLKK |||||||||||||||||| AMNGFQVGTKRLKVQLKK
Dihedral angle restraints
480-----490-------500-------510-------520-------530-------540-------550-------560-------570-------58 AAGLPQFGSASALSTSPLASVALSAAAAAAAGKQIEGPEGCNLFIYHLPQEFTDTDLASTFLPFGNVISAKVFIDKQTSLSKCFGFVSFDNPDSAQVAIK ||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| AAGLPQFGSASALSTSP..SVALSAAAAAAAGKQIEGPEGCNLFIYHLPQEFTDTDLASTFLPFGNVISAKVFIDKQTSLSKCFGFVSFDNPDSAQVAIK 0-------590------- AMNGFQVGTKRLKVQLKK |||||||||||||||||| AMNGFQVGTKRLKVQLKK