Solution Structure of RCL
GHMAASGEQA PCSVYFCGSI RGGREDQALY ARIVSRLRRY GKVLTEHVAD AELEPLGEEA AGGDQFIHEQ DLNWLQQADV VVAEVTQPSL GVGYELGRAV ALGKPILCLF RPQSGRVLSA MIRGAADGSR FQVWDYAEGE VETMLDRYFE AYLPQKTASS SHPSA
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 81.9 % (1502 of 1834) | 76.1 % (721 of 947) | 88.4 % (633 of 716) | 86.5 % (148 of 171) |
Backbone | 91.6 % (894 of 976) | 90.6 % (308 of 340) | 92.3 % (441 of 478) | 91.8 % (145 of 158) |
Sidechain | 74.6 % (750 of 1006) | 68.0 % (413 of 607) | 86.5 % (334 of 386) | 23.1 % (3 of 13) |
Aromatic | 58.9 % (86 of 146) | 58.9 % (43 of 73) | 57.7 % (41 of 71) | 100.0 % (2 of 2) |
Methyl | 98.3 % (177 of 180) | 97.8 % (88 of 90) | 98.9 % (89 of 90) |
1. RCL
GHMAASGEQA PCSVYFCGSI RGGREDQALY ARIVSRLRRY GKVLTEHVAD AELEPLGEEA AGGDQFIHEQ DLNWLQQADV VVAEVTQPSL GVGYELGRAV ALGKPILCLF RPQSGRVLSA MIRGAADGSR FQVWDYAEGE VETMLDRYFE AYLPQKTASS SHPSASolvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 25 mM | |
2 | sodium chloride | natural abundance | 25 mM | |
3 | DTT | natural abundance | 2 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | Pf1 phage | natural abundance | 12 % |
Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | sodium phosphate | natural abundance | 25 mM | |
7 | sodium chloride | natural abundance | 25 mM | |
8 | DTT | natural abundance | 2 mM | |
9 | sodium azide | natural abundance | 0.02 % |
Solvent system 100% D2O, Pressure 1.0 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | sodium phosphate | natural abundance | 25 mM | |
11 | sodium chloride | natural abundance | 25 mM | |
12 | DTT | natural abundance | 2 mM | |
13 | sodium azide | natural abundance | 0.02 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker Avance - 800 MHz Cryogenic triple-resonance probe with z-axis pulsed field gradients
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | sodium phosphate | natural abundance | 25 mM | |
7 | sodium chloride | natural abundance | 25 mM | |
8 | DTT | natural abundance | 2 mM | |
9 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz Cryogenic triple-resonance probe with z-axis pulsed field gradients
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | sodium phosphate | natural abundance | 25 mM | |
7 | sodium chloride | natural abundance | 25 mM | |
8 | DTT | natural abundance | 2 mM | |
9 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz Cryogenic triple-resonance probe with z-axis pulsed field gradients
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | sodium phosphate | natural abundance | 25 mM | |
7 | sodium chloride | natural abundance | 25 mM | |
8 | DTT | natural abundance | 2 mM | |
9 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz Cryogenic triple-resonance probe with z-axis pulsed field gradients
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | sodium phosphate | natural abundance | 25 mM | |
7 | sodium chloride | natural abundance | 25 mM | |
8 | DTT | natural abundance | 2 mM | |
9 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz Cryogenic triple-resonance probe with z-axis pulsed field gradients
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | sodium phosphate | natural abundance | 25 mM | |
7 | sodium chloride | natural abundance | 25 mM | |
8 | DTT | natural abundance | 2 mM | |
9 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz Cryogenic triple-resonance probe with z-axis pulsed field gradients
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | sodium phosphate | natural abundance | 25 mM | |
7 | sodium chloride | natural abundance | 25 mM | |
8 | DTT | natural abundance | 2 mM | |
9 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz Cryogenic triple-resonance probe with z-axis pulsed field gradients
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | sodium phosphate | natural abundance | 25 mM | |
7 | sodium chloride | natural abundance | 25 mM | |
8 | DTT | natural abundance | 2 mM | |
9 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz Cryogenic triple-resonance probe with z-axis pulsed field gradients
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | sodium phosphate | natural abundance | 25 mM | |
7 | sodium chloride | natural abundance | 25 mM | |
8 | DTT | natural abundance | 2 mM | |
9 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz Cryogenic triple-resonance probe with z-axis pulsed field gradients
State isotropic, Solvent system 100% D2O, Pressure 1.0 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | sodium phosphate | natural abundance | 25 mM | |
11 | sodium chloride | natural abundance | 25 mM | |
12 | DTT | natural abundance | 2 mM | |
13 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz Cryogenic triple-resonance probe with z-axis pulsed field gradients
State isotropic, Solvent system 100% D2O, Pressure 1.0 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | sodium phosphate | natural abundance | 25 mM | |
11 | sodium chloride | natural abundance | 25 mM | |
12 | DTT | natural abundance | 2 mM | |
13 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz Cryogenic triple-resonance probe with z-axis pulsed field gradients
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | sodium phosphate | natural abundance | 25 mM | |
7 | sodium chloride | natural abundance | 25 mM | |
8 | DTT | natural abundance | 2 mM | |
9 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz Cryogenic triple-resonance probe with z-axis pulsed field gradients
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | sodium phosphate | natural abundance | 25 mM | |
7 | sodium chloride | natural abundance | 25 mM | |
8 | DTT | natural abundance | 2 mM | |
9 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz Cryogenic triple-resonance probe with z-axis pulsed field gradients
State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 25 mM | |
2 | sodium chloride | natural abundance | 25 mM | |
3 | DTT | natural abundance | 2 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | Pf1 phage | natural abundance | 12 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_16258_2khz.nef |
Input source #2: Coordindates | 2khz.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------1 GHMAASGEQAPCSVYFCGSIRGGREDQALYARIVSRLRRYGKVLTEHVADAELEPLGEEAAGGDQFIHEQDLNWLQQADVVVAEVTQPSLGVGYELGRAV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GHMAASGEQAPCSVYFCGSIRGGREDQALYARIVSRLRRYGKVLTEHVADAELEPLGEEAAGGDQFIHEQDLNWLQQADVVVAEVTQPSLGVGYELGRAV --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 00-------110-------120-------130-------140-------150-------160--- ALGKPILCLFRPQSGRVLSAMIRGAADGSRFQVWDYAEGEVETMLDRYFEAYLPQKTASSSHPSA ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ALGKPILCLFRPQSGRVLSAMIRGAADGSRFQVWDYAEGEVETMLDRYFEAYLPQKTASSSHPSA -------110-------120-------130-------140-------150-------160-----
-200-----210-------220-------230-------240-------250-------260-------270-------280-------290-------3 GHMAASGEQAPCSVYFCGSIRGGREDQALYARIVSRLRRYGKVLTEHVADAELEPLGEEAAGGDQFIHEQDLNWLQQADVVVAEVTQPSLGVGYELGRAV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GHMAASGEQAPCSVYFCGSIRGGREDQALYARIVSRLRRYGKVLTEHVADAELEPLGEEAAGGDQFIHEQDLNWLQQADVVVAEVTQPSLGVGYELGRAV --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 00-------310-------320-------330-------340-------350-------360--- ALGKPILCLFRPQSGRVLSAMIRGAADGSRFQVWDYAEGEVETMLDRYFEAYLPQKTASSSHPSA ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ALGKPILCLFRPQSGRVLSAMIRGAADGSRFQVWDYAEGEVETMLDRYFEAYLPQKTASSSHPSA -------110-------120-------130-------140-------150-------160-----
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 165 | 0 | 0 | 100.0 |
B | B | 165 | 0 | 0 | 100.0 |
Content subtype: combined_16258_2khz.nef
Assigned chemical shifts
-0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------1 GHMAASGEQAPCSVYFCGSIRGGREDQALYARIVSRLRRYGKVLTEHVADAELEPLGEEAAGGDQFIHEQDLNWLQQADVVVAEVTQPSLGVGYELGRAV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..MAASGEQAPCSVYFCGSIRGGREDQALYARIVSRLRRYGKVLTEHVADAELEPLGEEAAGGDQFIHEQDLNWLQQADVVVAEVTQPSLGVGYELGRAV 00-------110-------120-------130-------140-------150-------160--- ALGKPILCLFRPQSGRVLSAMIRGAADGSRFQVWDYAEGEVETMLDRYFEAYLPQKTASSSHPSA ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||| ALGKPILCLFRPQSGRVLSAMIRGAADGSRFQVWDYAEGEVETMLDRYFEAYLPQKTAS..HPSA
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
106 | CYS | HG | 1.003 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 947 | 714 | 75.4 |
13C chemical shifts | 716 | 634 | 88.5 |
15N chemical shifts | 183 | 146 | 79.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 340 | 308 | 90.6 |
13C chemical shifts | 330 | 299 | 90.6 |
15N chemical shifts | 158 | 144 | 91.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 607 | 406 | 66.9 |
13C chemical shifts | 386 | 335 | 86.8 |
15N chemical shifts | 25 | 2 | 8.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 93 | 92 | 98.9 |
13C chemical shifts | 93 | 92 | 98.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 73 | 42 | 57.5 |
13C chemical shifts | 71 | 40 | 56.3 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
-0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------1 GHMAASGEQAPCSVYFCGSIRGGREDQALYARIVSRLRRYGKVLTEHVADAELEPLGEEAAGGDQFIHEQDLNWLQQADVVVAEVTQPSLGVGYELGRAV ||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||| .....SGEQAPCSVYFCGSIRGGREDQALYARIVSRLRRYGKVL.EHVADAELEPLGEEAAGGDQFIHEQDLNWLQQADVVVAEVTQPSLGVGYELGRAV -0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------1 00-------110-------120-------130-------140-------150-------160--- ALGKPILCLFRPQSGRVLSAMIRGAADGSRFQVWDYAEGEVETMLDRYFEAYLPQKTASSSHPSA ||||||||||||||||||||||||||||||||||||||||||||||||||||||||| | || ALGKPILCLFRPQSGRVLSAMIRGAADGSRFQVWDYAEGEVETMLDRYFEAYLPQKT.S..HP 00-------110-------120-------130-------140-------150-------160-
Dihedral angle restraints
-0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------1 GHMAASGEQAPCSVYFCGSIRGGREDQALYARIVSRLRRYGKVLTEHVADAELEPLGEEAAGGDQFIHEQDLNWLQQADVVVAEVTQPSLGVGYELGRAV |||||||| |||||||||||||||| ||| |||||||||||||||| |||||| |||||||||| ..........PCSVYFCG.....REDQALYARIVSRLRR..KVL..................GDQFIHEQDLNWLQQA.VVVAEV.....GVGYELGRAV -0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------1 00-------110-------120-------130-------140-------150-------160--- ALGKPILCLFRPQSGRVLSAMIRGAADGSRFQVWDYAEGEVETMLDRYFEAYLPQKTASSSHPSA |||||||||||||| ||||| |||||||||||||||||||||| ALGKPILCLFRPQS....SAMIR.......FQVWDYAEGEVETMLDRYFEAY 00-------110-------120-------130-------140-------150
RDC restraints