Solution NMR structure of tungsten formylmethanofuran dehydrogenase subunit D from Archaeoglobus fulgidus, Northeast Structural Genomics Consortium target AtT7
MGSSHHHHHH SSGRENLYFQ GHMLEVEVIS GRTLNQGATV EEKLTEEYFN AVNYAEINEE DWNALGLQEG DRVKVKTEFG EVVVFAKKGD VPKGMIFIPM GPYANMVIDP STDGTGMPQF KGVKGTVEKT DEKVLSVKEL LEAIGS
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 91.6 % (1529 of 1670) | 91.3 % (790 of 865) | 91.7 % (598 of 652) | 92.2 % (141 of 153) |
Backbone | 90.8 % (786 of 866) | 89.8 % (272 of 303) | 91.2 % (385 of 422) | 91.5 % (129 of 141) |
Sidechain | 92.3 % (862 of 934) | 92.2 % (518 of 562) | 92.2 % (332 of 360) | 100.0 % (12 of 12) |
Aromatic | 78.8 % (104 of 132) | 78.8 % (52 of 66) | 78.5 % (51 of 65) | 100.0 % (1 of 1) |
Methyl | 98.0 % (147 of 150) | 97.3 % (73 of 75) | 98.7 % (74 of 75) |
1. AtT7 protein
MGSSHHHHHH SSGRENLYFQ GHMLEVEVIS GRTLNQGATV EEKLTEEYFN AVNYAEINEE DWNALGLQEG DRVKVKTEFG EVVVFAKKGD VPKGMIFIPM GPYANMVIDP STDGTGMPQF KGVKGTVEKT DEKVLSVKEL LEAIGSSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AtT7 protein | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | benzamidine | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | AtT7 protein | [U-7% 13C; U-100% 15N] | 0.6 mM | |
8 | TRIS | natural abundance | 10 mM | |
9 | sodium chloride | natural abundance | 300 mM | |
10 | benzamidine | natural abundance | 1 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Solvent system 86% H2O/14% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | AtT7 protein | [U-7% 13C; U-100% 15N] | 0.4 mM | |
14 | TRIS | natural abundance | 6.6 mM | |
15 | sodium chloride | natural abundance | 200 mM | |
16 | benzamidine | natural abundance | 0.7 mM | |
17 | Pf1 phage | natural abundance | 13.25 g/L | |
18 | H2O | natural abundance | 86 % | |
19 | D2O | natural abundance | 14 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AtT7 protein | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | benzamidine | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AtT7 protein | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | benzamidine | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AtT7 protein | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | benzamidine | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AtT7 protein | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | benzamidine | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AtT7 protein | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | benzamidine | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AtT7 protein | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | benzamidine | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AtT7 protein | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | benzamidine | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AtT7 protein | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | benzamidine | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AtT7 protein | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | benzamidine | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AtT7 protein | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | benzamidine | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AtT7 protein | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | benzamidine | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AtT7 protein | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | benzamidine | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AtT7 protein | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | benzamidine | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AtT7 protein | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | benzamidine | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AtT7 protein | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | benzamidine | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AtT7 protein | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | benzamidine | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | AtT7 protein | [U-7% 13C; U-100% 15N] | 0.6 mM | |
8 | TRIS | natural abundance | 10 mM | |
9 | sodium chloride | natural abundance | 300 mM | |
10 | benzamidine | natural abundance | 1 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | AtT7 protein | [U-7% 13C; U-100% 15N] | 0.6 mM | |
8 | TRIS | natural abundance | 10 mM | |
9 | sodium chloride | natural abundance | 300 mM | |
10 | benzamidine | natural abundance | 1 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | AtT7 protein | [U-7% 13C; U-100% 15N] | 0.6 mM | |
8 | TRIS | natural abundance | 10 mM | |
9 | sodium chloride | natural abundance | 300 mM | |
10 | benzamidine | natural abundance | 1 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 86% H2O/14% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | AtT7 protein | [U-7% 13C; U-100% 15N] | 0.4 mM | |
14 | TRIS | natural abundance | 6.6 mM | |
15 | sodium chloride | natural abundance | 200 mM | |
16 | benzamidine | natural abundance | 0.7 mM | |
17 | Pf1 phage | natural abundance | 13.25 g/L | |
18 | H2O | natural abundance | 86 % | |
19 | D2O | natural abundance | 14 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 86% H2O/14% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | AtT7 protein | [U-7% 13C; U-100% 15N] | 0.4 mM | |
14 | TRIS | natural abundance | 6.6 mM | |
15 | sodium chloride | natural abundance | 200 mM | |
16 | benzamidine | natural abundance | 0.7 mM | |
17 | Pf1 phage | natural abundance | 13.25 g/L | |
18 | H2O | natural abundance | 86 % | |
19 | D2O | natural abundance | 14 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_16267_2ki8.nef |
Input source #2: Coordindates | 2ki8.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGSSHHHHHHSSGRENLYFQGHMLEVEVISGRTLNQGATVEEKLTEEYFNAVNYAEINEEDWNALGLQEGDRVKVKTEFGEVVVFAKKGDVPKGMIFIPM |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGSSHHHHHHSSGRENLYFQGHMLEVEVISGRTLNQGATVEEKLTEEYFNAVNYAEINEEDWNALGLQEGDRVKVKTEFGEVVVFAKKGDVPKGMIFIPM -------110-------120-------130-------140------ GPYANMVIDPSTDGTGMPQFKGVKGTVEKTDEKVLSVKELLEAIGS |||||||||||||||||||||||||||||||||||||||||||||| GPYANMVIDPSTDGTGMPQFKGVKGTVEKTDEKVLSVKELLEAIGS
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 146 | 0 | 0 | 100.0 |
Content subtype: combined_16267_2ki8.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGSSHHHHHHSSGRENLYFQGHMLEVEVISGRTLNQGATVEEKLTEEYFNAVNYAEINEEDWNALGLQEGDRVKVKTEFGEVVVFAKKGDVPKGMIFIPM ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...........SGRENLYFQGHMLEVEVISGRTLNQGATVEEKLTEEYFNAVNYAEINEEDWNALGLQEGDRVKVKTEFGEVVVFAKKGDVPKGMIFIPM -------110-------120-------130-------140------ GPYANMVIDPSTDGTGMPQFKGVKGTVEKTDEKVLSVKELLEAIGS |||||||||||||||||||||||||||||||||||||||||||||| GPYANMVIDPSTDGTGMPQFKGVKGTVEKTDEKVLSVKELLEAIGS
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
30 | SER | HG | 5.085 |
77 | THR | HG1 | 6.651 |
103 | TYR | HH | 9.364 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 865 | 802 | 92.7 |
13C chemical shifts | 652 | 604 | 92.6 |
15N chemical shifts | 156 | 142 | 91.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 303 | 279 | 92.1 |
13C chemical shifts | 292 | 270 | 92.5 |
15N chemical shifts | 141 | 129 | 91.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 562 | 523 | 93.1 |
13C chemical shifts | 360 | 334 | 92.8 |
15N chemical shifts | 15 | 13 | 86.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 81 | 80 | 98.8 |
13C chemical shifts | 81 | 80 | 98.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 66 | 52 | 78.8 |
13C chemical shifts | 65 | 51 | 78.5 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGSSHHHHHHSSGRENLYFQGHMLEVEVISGRTLNQGATVEEKLTEEYFNAVNYAEINEEDWNALGLQEGDRVKVKTEFGEVVVFAKKGDVPKGMIFIPM | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...........S.RENLYFQGHMLEVEVISGRTLNQGATVEEKLTEEYFNAVNYAEINEEDWNALGLQEGDRVKVKTEFGEVVVFAKKGDVPKGMIFIPM -------110-------120-------130-------140------ GPYANMVIDPSTDGTGMPQFKGVKGTVEKTDEKVLSVKELLEAIGS |||||||||||||||||||||||||||||||||||||||||||||| GPYANMVIDPSTDGTGMPQFKGVKGTVEKTDEKVLSVKELLEAIGS
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGSSHHHHHHSSGRENLYFQGHMLEVEVISGRTLNQGATVEEKLTEEYFNAVNYAEINEEDWNALGLQEGDRVKVKTEFGEVVVFAKKGDVPKGMIFIPM ||||||||| ||||| |||||||||||||||||||||| ||||||| |||||||||| |||||| .....................HMLEVEVIS........TVEEK.TEEYFNAVNYAEINEEDWNALG.....RVKVKTE.GEVVVFAKKG....GMIFIP. --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140------ GPYANMVIDPSTDGTGMPQFKGVKGTVEKTDEKVLSVKELLEAIGS |||||| ||||||| |||||||||| .PYANMV.................GTVEKTD....SVKELLEAIG -------110-------120-------130-------140-----