Properties

Disulfide bonds

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

Non-standard residues

Sequence alignments

• Entity_assembly_ID (NMR): A vs Auth_asym_ID (model): A

-60-------70--------80--------90-------100-------110-------120-------130-------140-------150-------1
MQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSI
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
MQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSI
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100

60-------170-------180-------190-------200------
RDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK
||||||||||||||||||||||||||||||||||||||||||||||||
RDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK
-------110-------120-------130-------140--------

• Entity_assembly_ID (NMR): C vs Auth_asym_ID (model): C

Chain assignments

Content subtype: combined_16270_2kid.nef

Assigned chemical shifts

1. Saveframe: assigned_chem_shift_list_1
   • Status: Warning
   • Sequence coverage of experimental data
     • Entity_assembly_ID: A, Chain length: 148, Sequence coverage: 100.0%

     -60-------70--------80--------90-------100-------110-------120-------130-------140-------150-------1
     MQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSI
     ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
     MQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSI
     
     60-------170-------180-------190-------200------
     RDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK
     ||||||||||||||||||||||||||||||||||||||||||||||||
     RDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK
     

     • Entity_assembly_ID: C, Chain length: 5, Sequence coverage: 80.0%

     -----
     XLPAX
      ||||
     .LPAX
     

   • Total number of assignments
     • ¹H chemical shifts: 859
     • ¹³C chemical shifts: 636
     • ¹⁵N chemical shifts: 157
   • Completeness of assignments
     • Entity_assemble_ID: A
       • Excluded Atom_ID in statistics

         Comp_index_ID	Comp_ID	Atom_ID	CS value (ppm)
         131	THR	HG1	6.45
         180	THR	HG1	7.2

       • All atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	929	836	90.0
         13C chemical shifts	680	621	91.3
         15N chemical shifts	159	154	96.9

       • Backbone atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	296	293	99.0
         13C chemical shifts	296	282	95.3
         15N chemical shifts	139	137	98.6

       • Side chain atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	633	543	85.8
         13C chemical shifts	384	339	88.3
         15N chemical shifts	20	17	85.0

       • Methyl group atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	76	76	100.0
         13C chemical shifts	76	76	100.0

       • Aromatic group atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	57	26	45.6
         13C chemical shifts	56	25	44.6
         15N chemical shifts	1	1	100.0

     • Entity_assemble_ID: C
       • Excluded Comp_ID in statistics

         Comp_index_ID	Comp_ID
         701	PHQ
         705	B27

       • All atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	17	15	88.2
         13C chemical shifts	14	12	85.7
         15N chemical shifts	2	2	100.0

       • Backbone atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	5	5	100.0
         13C chemical shifts	6	4	66.7
         15N chemical shifts	2	2	100.0

       • Side chain atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	12	10	83.3
         13C chemical shifts	8	8	100.0

       • Methyl group atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	3	3	100.0
         13C chemical shifts	3	3	100.0

       • Aromatic group atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)

   • Redox state of CYS
     • A:184:CYS, CA: 54.44 ppm, CB: 44.25 ppm
       • Redox_state (pred. by CS): oxidized
       • Disulfide_bond (coordinates): False, Other_bond (coordinates): False
   • Peptide bond of PRO
     • A:63:PRO, CB: 32.35 ppm, CG: 27.87 ppm
       • Peptide_bond (pred. by CS): trans
       • Peptide_bond (coordinates): trans
     • A:66:PRO, CB: 33.13 ppm, CG: 27.52 ppm
       • Peptide_bond (pred. by CS): trans
       • Peptide_bond (coordinates): trans
     • A:79:PRO, CB: 32.34 ppm, CG: 27.52 ppm
       • Peptide_bond (pred. by CS): trans
       • Peptide_bond (coordinates): trans
     • A:86:PRO, CB: 33.07 ppm, CG: 27.36 ppm
       • Peptide_bond (pred. by CS): trans
       • Peptide_bond (coordinates): trans
     • A:89:PRO, CB: 34.09 ppm, CG: 30.46 ppm
       • Peptide_bond (pred. by CS): trans
       • Peptide_bond (coordinates): trans
     • A:91:PRO, CB: 35.6 ppm, CG: 24.41 ppm
       • Peptide_bond (pred. by CS): cis
       • Peptide_bond (coordinates): cis
     • A:94:PRO, CB: 31.91 ppm, CG: 28.4 ppm
       • Peptide_bond (pred. by CS): trans
       • Peptide_bond (coordinates): trans
     • A:126:PRO, CB: 32.83 ppm, CG: 27.55 ppm
       • Peptide_bond (pred. by CS): trans
       • Peptide_bond (coordinates): trans
     • A:163:PRO, CB: 32.53 ppm, CG: 29.35 ppm
       • Peptide_bond (pred. by CS): trans
       • Peptide_bond (coordinates): trans
     • C:703:PRO, CB: 29.32 ppm, CG: 25.19 ppm
       • Peptide_bond (pred. by CS): trans
       • Peptide_bond (coordinates): trans
   • Rotameric state of ILE , LEU, and VAL
     • A:65:ILE, CD1: 12.43 ppm
       • Rotameric_state (pred. by CS): gauche+ 2.7%, trans 54.2%, gauche- 43.1%
       • Rotameric_state (coordinates): gauche+
     • A:72:VAL, CG1: 22.52 ppm, CG2: 23.34 ppm
       • Rotameric_state (pred. by CS): gauche+ 21.8%, trans 66.0%, gauche- 12.2%
       • Rotameric_state (coordinates): gauche-
     • A:76:ILE, CD1: 15.57 ppm
       • Rotameric_state (pred. by CS): gauche+ 4.7%, trans 95.3%, gauche- 0.0%
       • Rotameric_state (coordinates): trans
     • A:78:ILE, CD1: 15.57 ppm
       • Rotameric_state (pred. by CS): gauche+ 4.7%, trans 95.3%, gauche- 0.0%
       • Rotameric_state (coordinates): trans
     • A:83:ILE, CD1: 15.63 ppm
       • Rotameric_state (pred. by CS): gauche+ 4.7%, trans 95.3%, gauche- 0.0%
       • Rotameric_state (coordinates): trans
     • A:87:VAL, CG1: 21.6 ppm, CG2: 21.66 ppm
       • Rotameric_state (pred. by CS): gauche+ 35.0%, trans 41.0%, gauche- 24.0%
       • Rotameric_state (coordinates): trans
     • A:97:LEU, CD1: 27.52 ppm, CD2: 23.81 ppm
       • Rotameric_state (pred. by CS): gauche+ 12.9%, trans 87.1%, gauche- 0.0%
       • Rotameric_state (coordinates): trans
     • A:101:VAL, CG1: 21.43 ppm, CG2: 22.72 ppm
       • Rotameric_state (pred. by CS): gauche+ 34.8%, trans 52.2%, gauche- 13.0%
       • Rotameric_state (coordinates): gauche-
     • A:110:LEU, CD1: 23.06 ppm, CD2: 26.09 ppm
       • Rotameric_state (pred. by CS): gauche+ 80.3%, trans 19.7%, gauche- 0.0%
       • Rotameric_state (coordinates): unspecified gauche+ 45.0%, trans 45.0%, gauche- 10.0%
     • A:115:ILE, CD1: 15.22 ppm
       • Rotameric_state (pred. by CS): gauche+ 4.7%, trans 95.3%, gauche- 0.0%
       • Rotameric_state (coordinates): trans
     • A:117:ILE, CD1: 14.58 ppm
       • Rotameric_state (pred. by CS): gauche+ 4.5%, trans 91.5%, gauche- 4.0%
       • Rotameric_state (coordinates): trans
     • A:123:ILE, CD1: 13.44 ppm
       • Rotameric_state (pred. by CS): gauche+ 3.5%, trans 71.7%, gauche- 24.7%
       • Rotameric_state (coordinates): trans
     • A:133:LEU, CD1: 23.88 ppm, CD2: 25.92 ppm
       • Rotameric_state (pred. by CS): gauche+ 70.4%, trans 29.6%, gauche- 0.0%
       • Rotameric_state (coordinates): gauche-
     • A:142:VAL, CG1: 21.88 ppm, CG2: 21.14 ppm
       • Rotameric_state (pred. by CS): gauche+ 31.4%, trans 35.7%, gauche- 32.8%
       • Rotameric_state (coordinates): trans
     • A:146:VAL, CG1: 19.52 ppm, CG2: 21.73 ppm
       • Rotameric_state (pred. by CS): gauche+ 61.5%, trans 27.7%, gauche- 10.8%
       • Rotameric_state (coordinates): gauche+
     • A:158:ILE, CD1: 14.79 ppm
       • Rotameric_state (pred. by CS): gauche+ 4.7%, trans 95.1%, gauche- 0.2%
       • Rotameric_state (coordinates): trans
     • A:161:VAL, CG1: 21.83 ppm, CG2: 19.82 ppm
       • Rotameric_state (pred. by CS): gauche+ 27.6%, trans 20.4%, gauche- 52.0%
       • Rotameric_state (coordinates): gauche-
     • A:166:VAL, CG1: 18.64 ppm, CG2: 21.88 ppm
       • Rotameric_state (pred. by CS): gauche+ 71.2%, trans 22.2%, gauche- 6.7%
       • Rotameric_state (coordinates): gauche-
     • A:168:VAL, CG1: 21.84 ppm, CG2: 20.35 ppm
       • Rotameric_state (pred. by CS): gauche+ 29.8%, trans 26.1%, gauche- 44.1%
       • Rotameric_state (coordinates): gauche-
     • A:169:LEU, CD1: 25.57 ppm, CD2: 23.1 ppm
       • Rotameric_state (pred. by CS): gauche+ 25.3%, trans 74.7%, gauche- 0.0%
       • Rotameric_state (coordinates): trans
     • A:179:LEU, CD1: 24.0 ppm, CD2: 27.07 ppm
       • Rotameric_state (pred. by CS): gauche+ 80.7%, trans 19.3%, gauche- 0.0%
       • Rotameric_state (coordinates): gauche+
     • A:181:LEU, CD1: 25.07 ppm, CD2: 26.04 ppm
       • Rotameric_state (pred. by CS): gauche+ 59.7%, trans 40.3%, gauche- 0.0%
       • Rotameric_state (coordinates): gauche+
     • A:182:ILE, CD1: 16.08 ppm
       • Rotameric_state (pred. by CS): gauche+ 4.7%, trans 95.3%, gauche- 0.0%
       • Rotameric_state (coordinates): trans
     • A:193:VAL, CG1: 20.89 ppm, CG2: 21.88 ppm
       • Rotameric_state (pred. by CS): gauche+ 43.7%, trans 39.2%, gauche- 17.1%
       • Rotameric_state (coordinates): trans
     • A:199:ILE, CD1: 12.23 ppm
       • Rotameric_state (pred. by CS): gauche+ 2.5%, trans 50.8%, gauche- 46.7%
       • Rotameric_state (coordinates): gauche+
     • A:201:VAL, CG1: 22.0 ppm, CG2: 21.84 ppm
       • Rotameric_state (pred. by CS): gauche+ 30.3%, trans 45.2%, gauche- 24.6%
       • Rotameric_state (coordinates): trans
     • A:205:VAL, CG1: 21.9 ppm, CG2: 21.27 ppm
       • Rotameric_state (pred. by CS): gauche+ 31.3%, trans 37.4%, gauche- 31.2%
       • Rotameric_state (coordinates): trans
     • C:702:LEU, CD1: 21.81 ppm, CD2: 23.63 ppm
       • Rotameric_state (pred. by CS): gauche+ 68.2%, trans 31.8%, gauche- 0.0%
       • Rotameric_state (coordinates): gauche+
   • Histogram of normalized assigned chemical shifts
   • Random coil index and derived parameters (S² and NMR RMSD)
     • Chain_ID: A
     • Chain_ID: C

Covalent bonds

1. Saveframe: assembly
   • Status: OK

Distance restraints

1. Saveframe: CNS/XPLOR_distance_constraints_2
   • Status: Warning
   • Experiment type: noe
   • Sequence coverage of experimental data
     • Entity_assembly_ID: A, Chain length: 148, Sequence coverage: 8.8%
     • Entity_assembly_ID: C, Chain length: 5, Sequence coverage: 80.0%

     -----
     XLPAX
      ||||
     .LPAX
     

   • Total number of restraints: 85
     • Inter-chain restraints: 7
     • Symmetric restraints: 78
   • Weight of restraints: 1.0 (85)
     • Inter-chain restraints: 1.0 (7)
     • Symmetric restraints: 1.0 (78)
   • Potential type of restraints: square-well-parabolic (85)
     • Inter-chain restraints: square-well-parabolic (7)
     • Symmetric restraints: square-well-parabolic (78)
   • Range of distance target values: 2.25, 4.15 (Å)
   • Histogram of distance target values
   • Distance restraints per residue
     • Chain_ID: A
     • Chain_ID: B
       None
     • Chain_ID: C
   • Distance restraints on contact map
     • Chain_ID_1: C - Chain_ID_2: C
       None
   • Saveframe: CNS/XPLOR_distance_constraints_3
     • Status: Warning
     • Experiment type: undefined
     • Sequence coverage of experimental data
       • Entity_assembly_ID: B, Chain length: 1, Sequence coverage: 100.0%

       -
       X
       |
       X
       

     • Total number of restraints: 6
       • Total other bond restraints: 6
     • Weight of restraints: 1.0 (6)
       • Total other bond restraints: 1.0 (6)
     • Potential type of restraints: square-well-parabolic (6)
       • Total other bond restraints: square-well-parabolic (6)
     • Range of distance target values: 2.3, 2.3 (Å)
     • Distance restraints per residue
       • Chain_ID: A
       • Chain_ID: B
       • Chain_ID: C
         None
     • Distance restraints on contact map
       • Chain_ID_1: B - Chain_ID_2: B
         None
     • Saveframe: CNS/XPLOR_distance_constraints_10
       • Status: Warning
       • Experiment type: noe
       • Sequence coverage of experimental data
         • Entity_assembly_ID: A, Chain length: 148, Sequence coverage: 99.3%

         -60-------70--------80--------90-------100-------110-------120-------130-------140-------150-------1
         MQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSI
          |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
         .QAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSI
         
         60-------170-------180-------190-------200------
         RDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK
         ||||||||||||||||||||||||||||||||||||||||||||||||
         RDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK
         

       • Total number of restraints: 4079
         • Intra-residue restraints, i = j : 1335
         • Sequential restraints, | i - j | = 1 : 902
           • Backbone-backbone: 249
           • Backbone-side chain: 550
           • Side chain-side chain: 103
         • Medium range restraints, 1 < | i - j | < 5 : 463
           • Backbone-backbone: 73
           • Backbone-side chain: 187
           • Side chain-side chain: 203
         • Long range restraints, | i - j | >= 5 : 1379
       • Weight of restraints: 1.0 (4079)
         • Intra-residue restraints, i = j : 1.0 (1335)
         • Sequential restraints, | i - j | = 1 : 1.0 (902)
           • Backbone-backbone: 1.0 (249)
           • Backbone-side chain: 1.0 (550)
           • Side chain-side chain: 1.0 (103)
         • Medium range restraints, 1 < | i - j | < 5 : 1.0 (463)
           • Backbone-backbone: 1.0 (73)
           • Backbone-side chain: 1.0 (187)
           • Side chain-side chain: 1.0 (203)
         • Long range restraints, | i - j | >= 5 : 1.0 (1379)
       • Potential type of restraints: square-well-parabolic (4079)
         • Intra-residue restraints, i = j : square-well-parabolic (1335)
         • Sequential restraints, | i - j | = 1 : square-well-parabolic (902)
           • Backbone-backbone: square-well-parabolic (249)
           • Backbone-side chain: square-well-parabolic (550)
           • Side chain-side chain: square-well-parabolic (103)
         • Medium range restraints, 1 < | i - j | < 5 : square-well-parabolic (463)
           • Backbone-backbone: square-well-parabolic (73)
           • Backbone-side chain: square-well-parabolic (187)
           • Side chain-side chain: square-well-parabolic (203)
         • Long range restraints, | i - j | >= 5 : square-well-parabolic (1379)
       • Range of distance target values: 2.23, 4.37 (Å)
       • Histogram of distance target values
       • Distance restraints per residue
         • Chain_ID: A
         • Chain_ID: B
           None
         • Chain_ID: C
           None
       • Distance restraints on contact map
         • Chain_ID_1: A - Chain_ID_2: A
       • Saveframe: CNS/XPLOR_distance_constraints_4
         • Status: OK
         • Experiment type: hbond
         • Sequence coverage of experimental data
           • Entity_assembly_ID: A, Chain length: 148, Sequence coverage: 42.6%
         • Total number of restraints: 96
           • Total hydrogen bond restraints: 96
             • O...H-x: 11
             • O...h-N: 11
             • Long range: 74
               • O...H-x: 37
               • O...h-N: 37
         • Weight of restraints: 1.0 (96)
           • Total hydrogen bond restraints: 1.0 (96)
             • O...H-x: 1.0 (11)
             • O...h-N: 1.0 (11)
             • Long range: 1.0 (74)
               • O...H-x: 1.0 (37)
               • O...h-N: 1.0 (37)
         • Potential type of restraints: square-well-parabolic (96)
           • Total hydrogen bond restraints: square-well-parabolic (96)
             • O...H-x: square-well-parabolic (11)
             • O...h-N: square-well-parabolic (11)
             • Long range: square-well-parabolic (74)
               • O...H-x: square-well-parabolic (37)
               • O...h-N: square-well-parabolic (37)
         • Range of distance target values: 2.0, 3.0 (Å)
         • Histogram of distance target values
         • Distance restraints per residue
           • Chain_ID: A
           • Chain_ID: B
             None
           • Chain_ID: C
             None
         • Distance restraints on contact map

Dihedral angle restraints

1. Saveframe: CNS/XPLOR_dihedral_6
   • Status: OK
   • Experiment type: .
   • Sequence coverage of experimental data
     • Entity_assembly_ID: A, Chain length: 148, Sequence coverage: 99.3%

     -60-------70--------80--------90-------100-------110-------120-------130-------140-------150-------1
     MQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSI
     |||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||
     MQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVS.AEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSI
     
     60-------170-------180-------190-------200------
     RDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK
     ||||||||||||||||||||||||||||||||||||||||||||||||
     RDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK
     

     • Entity_assembly_ID: C, Chain length: 5, Sequence coverage: 60.0%

     -----
     XLPAX
      ||| 
     .LPA 
     ---- 
     

   • Total number of restraints: 260
     • Phi angle constraints: 135
     • Psi angle constraints: 104
     • Chi1 angle constraints: 21
   • Total number of restraints per polymer type: 260
     • Protein: 260
   • Weight of restraints: 1.0 (260)
     • Phi angle constraints: 1.0 (135)
     • Psi angle constraints: 1.0 (104)
     • Chi1 angle constraints: 1.0 (21)
   • Potential type of restraints: square-well-parabolic (260)
     • Phi angle constraints: square-well-parabolic (135)
     • Psi angle constraints: square-well-parabolic (104)
     • Chi1 angle constraints: square-well-parabolic (21)
   • Plot of Phi-Psi angle restraints
   • Dihedral angle restraints per residue
     • Chain_ID: A
     • Chain_ID: C

RDC restraints

1. Saveframe: CNS/XPLOR_dipolar_coupling_8
   • Status: OK
   • Experiment type: .
   • Sequence coverage of experimental data
     • Entity_assembly_ID: A, Chain length: 148, Sequence coverage: 37.2%
   • Total number of restraints: 66
     • H-N bond vectors: 66
   • Potential type of restraints: undefined (66)
     • H-N bond vectors: undefined (66)
   • Range of observed RDC values: 100.0, -100.0 (Hz)
   • RDC restraints per residue
   • Saveframe: CNS/XPLOR_dipolar_coupling_9
     • Status: OK
     • Experiment type: .
     • Sequence coverage of experimental data
       • Entity_assembly_ID: A, Chain length: 148, Sequence coverage: 62.2%

       -60-------70--------80--------90-------100-------110-------120-------130-------140-------150-------1
       MQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSI
         ||||   |||| ||||| |||||||   |||||   |||       ||| || ||  ||   ||      |||||||||  ||||||||||  |||||
       ..AKPQ...DKSK.AGYIE.PDADIKE...PGPAT...LNR.......NES.DD.NI..AG...ID......TNLKAAKKG..VYFKVGNETR..KMTSI
       
       60-------170-------180-------190-------200------
       RDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK
       | || ||| ||  ||||||| ||     ||||||       || ||||
       R.VK.TDV.VL..QKGKDKQ.TL.....YNEKTG.......FV.TEVK
       

     • Total number of restraints: 61
       • C-N bond vectors: 61
     • Potential type of restraints: undefined (61)
       • C-N bond vectors: undefined (61)
     • Range of observed RDC values: 100.0, -100.0 (Hz)
     • RDC restraints per residue
       • Chain_ID: A
         None