Solution NMR structure of an O6-methylguanine DNA methyltransferase family protein from Vibrio parahaemolyticus. Northeast Structural Genomics Consortium target VpR247.
MDQFLVQIFA VIHQIPKGKV STYGEIAKMA GYPGYARHVG KALGNLPEGS KLPWFRVINS QGKISLKGRD LDRQKQKLEA EGIEVSEIGK IALRKYKWQP LEHHHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 93.1 % (1231 of 1322) | 93.3 % (650 of 697) | 93.3 % (477 of 511) | 91.2 % (104 of 114) |
Backbone | 92.0 % (587 of 638) | 91.4 % (203 of 222) | 93.0 % (291 of 313) | 90.3 % (93 of 103) |
Sidechain | 94.1 % (735 of 781) | 94.1 % (447 of 475) | 93.9 % (277 of 295) | 100.0 % (11 of 11) |
Aromatic | 79.7 % (94 of 118) | 79.7 % (47 of 59) | 78.9 % (45 of 57) | 100.0 % (2 of 2) |
Methyl | 100.0 % (112 of 112) | 100.0 % (56 of 56) | 100.0 % (56 of 56) |
1. VpR247
MDQFLVQIFA VIHQIPKGKV STYGEIAKMA GYPGYARHVG KALGNLPEGS KLPWFRVINS QGKISLKGRD LDRQKQKLEA EGIEVSEIGK IALRKYKWQP LEHHHHHHSolvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 6.5, Details 5-mm Shigemi
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VpR247 | [U-100% 13C; U-100% 15N] | 0.94 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H20 | natural abundance | 90 % | |
9 | D20 | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 6.5, Details 1.7-mm microtube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | VpR247 | [U-100% 13C; U-100% 15N] | 0.94 mM | |
11 | MES | natural abundance | 20 mM | |
12 | sodium chloride | natural abundance | 200 mM | |
13 | calcium chloride | natural abundance | 5 mM | |
14 | DTT | natural abundance | 10 mM | |
15 | sodium azide | natural abundance | 0.02 % | |
16 | DSS | natural abundance | 50 uM | |
17 | H20 | natural abundance | 90 % | |
18 | D20 | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 6.5, Details 1.7-mm microtube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
19 | VpR247 | [U-5% 13C; U-100% 15N] | 0.92 mM | |
20 | MES | natural abundance | 20 mM | |
21 | sodium chloride | natural abundance | 200 mM | |
22 | calcium chloride | natural abundance | 5 mM | |
23 | DTT | natural abundance | 10 mM | |
24 | sodium azide | natural abundance | 0.02 % | |
25 | DSS | natural abundance | 50 uM | |
26 | H20 | natural abundance | 90 % | |
27 | D20 | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 800 MHz 5-mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 6.5, Details 5-mm Shigemi
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VpR247 | [U-100% 13C; U-100% 15N] | 0.94 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H20 | natural abundance | 90 % | |
9 | D20 | natural abundance | 10 % |
Bruker Avance - 800 MHz 5-mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 6.5, Details 5-mm Shigemi
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VpR247 | [U-100% 13C; U-100% 15N] | 0.94 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H20 | natural abundance | 90 % | |
9 | D20 | natural abundance | 10 % |
Bruker Avance - 800 MHz 5-mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 6.5, Details 5-mm Shigemi
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VpR247 | [U-100% 13C; U-100% 15N] | 0.94 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H20 | natural abundance | 90 % | |
9 | D20 | natural abundance | 10 % |
Bruker Avance - 800 MHz 5-mm TXI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 6.5, Details 5-mm Shigemi
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VpR247 | [U-100% 13C; U-100% 15N] | 0.94 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H20 | natural abundance | 90 % | |
9 | D20 | natural abundance | 10 % |
Bruker Avance - 600 MHz 1.7-mm microcyroprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 6.5, Details 1.7-mm microtube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | VpR247 | [U-100% 13C; U-100% 15N] | 0.94 mM | |
11 | MES | natural abundance | 20 mM | |
12 | sodium chloride | natural abundance | 200 mM | |
13 | calcium chloride | natural abundance | 5 mM | |
14 | DTT | natural abundance | 10 mM | |
15 | sodium azide | natural abundance | 0.02 % | |
16 | DSS | natural abundance | 50 uM | |
17 | H20 | natural abundance | 90 % | |
18 | D20 | natural abundance | 10 % |
Bruker Avance - 600 MHz 1.7-mm microcyroprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 6.5, Details 1.7-mm microtube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | VpR247 | [U-100% 13C; U-100% 15N] | 0.94 mM | |
11 | MES | natural abundance | 20 mM | |
12 | sodium chloride | natural abundance | 200 mM | |
13 | calcium chloride | natural abundance | 5 mM | |
14 | DTT | natural abundance | 10 mM | |
15 | sodium azide | natural abundance | 0.02 % | |
16 | DSS | natural abundance | 50 uM | |
17 | H20 | natural abundance | 90 % | |
18 | D20 | natural abundance | 10 % |
Bruker Avance - 600 MHz 1.7-mm microcyroprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 6.5, Details 1.7-mm microtube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | VpR247 | [U-100% 13C; U-100% 15N] | 0.94 mM | |
11 | MES | natural abundance | 20 mM | |
12 | sodium chloride | natural abundance | 200 mM | |
13 | calcium chloride | natural abundance | 5 mM | |
14 | DTT | natural abundance | 10 mM | |
15 | sodium azide | natural abundance | 0.02 % | |
16 | DSS | natural abundance | 50 uM | |
17 | H20 | natural abundance | 90 % | |
18 | D20 | natural abundance | 10 % |
Bruker Avance - 600 MHz 1.7-mm microcyroprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 6.5, Details 1.7-mm microtube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | VpR247 | [U-100% 13C; U-100% 15N] | 0.94 mM | |
11 | MES | natural abundance | 20 mM | |
12 | sodium chloride | natural abundance | 200 mM | |
13 | calcium chloride | natural abundance | 5 mM | |
14 | DTT | natural abundance | 10 mM | |
15 | sodium azide | natural abundance | 0.02 % | |
16 | DSS | natural abundance | 50 uM | |
17 | H20 | natural abundance | 90 % | |
18 | D20 | natural abundance | 10 % |
Bruker Avance - 600 MHz 1.7-mm microcyroprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 6.5, Details 1.7-mm microtube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | VpR247 | [U-100% 13C; U-100% 15N] | 0.94 mM | |
11 | MES | natural abundance | 20 mM | |
12 | sodium chloride | natural abundance | 200 mM | |
13 | calcium chloride | natural abundance | 5 mM | |
14 | DTT | natural abundance | 10 mM | |
15 | sodium azide | natural abundance | 0.02 % | |
16 | DSS | natural abundance | 50 uM | |
17 | H20 | natural abundance | 90 % | |
18 | D20 | natural abundance | 10 % |
Bruker Avance - 600 MHz 1.7-mm microcyroprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 6.5, Details 1.7-mm microtube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | VpR247 | [U-100% 13C; U-100% 15N] | 0.94 mM | |
11 | MES | natural abundance | 20 mM | |
12 | sodium chloride | natural abundance | 200 mM | |
13 | calcium chloride | natural abundance | 5 mM | |
14 | DTT | natural abundance | 10 mM | |
15 | sodium azide | natural abundance | 0.02 % | |
16 | DSS | natural abundance | 50 uM | |
17 | H20 | natural abundance | 90 % | |
18 | D20 | natural abundance | 10 % |
Bruker Avance - 600 MHz 1.7-mm microcyroprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 6.5, Details 1.7-mm microtube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | VpR247 | [U-100% 13C; U-100% 15N] | 0.94 mM | |
11 | MES | natural abundance | 20 mM | |
12 | sodium chloride | natural abundance | 200 mM | |
13 | calcium chloride | natural abundance | 5 mM | |
14 | DTT | natural abundance | 10 mM | |
15 | sodium azide | natural abundance | 0.02 % | |
16 | DSS | natural abundance | 50 uM | |
17 | H20 | natural abundance | 90 % | |
18 | D20 | natural abundance | 10 % |
Bruker Avance - 600 MHz 1.7-mm microcyroprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 6.5, Details 1.7-mm microtube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | VpR247 | [U-100% 13C; U-100% 15N] | 0.94 mM | |
11 | MES | natural abundance | 20 mM | |
12 | sodium chloride | natural abundance | 200 mM | |
13 | calcium chloride | natural abundance | 5 mM | |
14 | DTT | natural abundance | 10 mM | |
15 | sodium azide | natural abundance | 0.02 % | |
16 | DSS | natural abundance | 50 uM | |
17 | H20 | natural abundance | 90 % | |
18 | D20 | natural abundance | 10 % |
Bruker Avance - 600 MHz 1.7-mm microcyroprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 6.5, Details 1.7-mm microtube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | VpR247 | [U-100% 13C; U-100% 15N] | 0.94 mM | |
11 | MES | natural abundance | 20 mM | |
12 | sodium chloride | natural abundance | 200 mM | |
13 | calcium chloride | natural abundance | 5 mM | |
14 | DTT | natural abundance | 10 mM | |
15 | sodium azide | natural abundance | 0.02 % | |
16 | DSS | natural abundance | 50 uM | |
17 | H20 | natural abundance | 90 % | |
18 | D20 | natural abundance | 10 % |
Bruker Avance - 600 MHz 1.7-mm microcyroprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 6.5, Details 1.7-mm microtube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | VpR247 | [U-100% 13C; U-100% 15N] | 0.94 mM | |
11 | MES | natural abundance | 20 mM | |
12 | sodium chloride | natural abundance | 200 mM | |
13 | calcium chloride | natural abundance | 5 mM | |
14 | DTT | natural abundance | 10 mM | |
15 | sodium azide | natural abundance | 0.02 % | |
16 | DSS | natural abundance | 50 uM | |
17 | H20 | natural abundance | 90 % | |
18 | D20 | natural abundance | 10 % |
Bruker Avance - 600 MHz 1.7-mm microcyroprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 6.5, Details 1.7-mm microtube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | VpR247 | [U-100% 13C; U-100% 15N] | 0.94 mM | |
11 | MES | natural abundance | 20 mM | |
12 | sodium chloride | natural abundance | 200 mM | |
13 | calcium chloride | natural abundance | 5 mM | |
14 | DTT | natural abundance | 10 mM | |
15 | sodium azide | natural abundance | 0.02 % | |
16 | DSS | natural abundance | 50 uM | |
17 | H20 | natural abundance | 90 % | |
18 | D20 | natural abundance | 10 % |
Bruker Avance - 600 MHz 1.7-mm microcyroprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 6.5, Details 1.7-mm microtube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | VpR247 | [U-100% 13C; U-100% 15N] | 0.94 mM | |
11 | MES | natural abundance | 20 mM | |
12 | sodium chloride | natural abundance | 200 mM | |
13 | calcium chloride | natural abundance | 5 mM | |
14 | DTT | natural abundance | 10 mM | |
15 | sodium azide | natural abundance | 0.02 % | |
16 | DSS | natural abundance | 50 uM | |
17 | H20 | natural abundance | 90 % | |
18 | D20 | natural abundance | 10 % |
Bruker Avance - 600 MHz 1.7-mm microcyroprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 6.5, Details 1.7-mm microtube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
19 | VpR247 | [U-5% 13C; U-100% 15N] | 0.92 mM | |
20 | MES | natural abundance | 20 mM | |
21 | sodium chloride | natural abundance | 200 mM | |
22 | calcium chloride | natural abundance | 5 mM | |
23 | DTT | natural abundance | 10 mM | |
24 | sodium azide | natural abundance | 0.02 % | |
25 | DSS | natural abundance | 50 uM | |
26 | H20 | natural abundance | 90 % | |
27 | D20 | natural abundance | 10 % |
Bruker Avance - 600 MHz 1.7-mm microcyroprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 6.5, Details 1.7-mm microtube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
19 | VpR247 | [U-5% 13C; U-100% 15N] | 0.92 mM | |
20 | MES | natural abundance | 20 mM | |
21 | sodium chloride | natural abundance | 200 mM | |
22 | calcium chloride | natural abundance | 5 mM | |
23 | DTT | natural abundance | 10 mM | |
24 | sodium azide | natural abundance | 0.02 % | |
25 | DSS | natural abundance | 50 uM | |
26 | H20 | natural abundance | 90 % | |
27 | D20 | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_16272_2kif.nef |
Input source #2: Coordindates | 2kif.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MDQFLVQIFAVIHQIPKGKVSTYGEIAKMAGYPGYARHVGKALGNLPEGSKLPWFRVINSQGKISLKGRDLDRQKQKLEAEGIEVSEIGKIALRKYKWQP |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MDQFLVQIFAVIHQIPKGKVSTYGEIAKMAGYPGYARHVGKALGNLPEGSKLPWFRVINSQGKISLKGRDLDRQKQKLEAEGIEVSEIGKIALRKYKWQP -------- LEHHHHHH |||||||| LEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 108 | 0 | 0 | 100.0 |
Content subtype: combined_16272_2kif.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MDQFLVQIFAVIHQIPKGKVSTYGEIAKMAGYPGYARHVGKALGNLPEGSKLPWFRVINSQGKISLKGRDLDRQKQKLEAEGIEVSEIGKIALRKYKWQP |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MDQFLVQIFAVIHQIPKGKVSTYGEIAKMAGYPGYARHVGKALGNLPEGSKLPWFRVINSQGKISLKGRDLDRQKQKLEAEGIEVSEIGKIALRKYKWQP --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------- LEHHHHHH || LE --
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
3 | GLN | CD | 180.286 |
7 | GLN | CD | 179.875 |
14 | GLN | CD | 180.897 |
45 | ASN | CG | 177.866 |
59 | ASN | CG | 177.38 |
61 | GLN | CD | 180.856 |
74 | GLN | CD | 176.503 |
76 | GLN | CD | 180.391 |
99 | GLN | CD | 181.015 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 697 | 652 | 93.5 |
13C chemical shifts | 511 | 477 | 93.3 |
15N chemical shifts | 119 | 104 | 87.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 222 | 205 | 92.3 |
13C chemical shifts | 216 | 200 | 92.6 |
15N chemical shifts | 103 | 92 | 89.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 475 | 447 | 94.1 |
13C chemical shifts | 295 | 277 | 93.9 |
15N chemical shifts | 16 | 12 | 75.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 58 | 58 | 100.0 |
13C chemical shifts | 58 | 58 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 59 | 47 | 79.7 |
13C chemical shifts | 57 | 45 | 78.9 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MDQFLVQIFAVIHQIPKGKVSTYGEIAKMAGYPGYARHVGKALGNLPEGSKLPWFRVINSQGKISLKGRDLDRQKQKLEAEGIEVSEIGKIALRKYKWQP |||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||| MDQFLVQIFAVIHQIPKGKVSTYGEIAKMAGYPGYARHVGKALGNLPE.SKLPWFRVINSQGKISLKGRDLDRQKQKLEAEGIEVSEIGKIALRKYKWQP --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------- LEHHHHHH || LE --
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MDQFLVQIFAVIHQIPKGKVSTYGEIAKMAGYPGYARHVGKALGNLPEGSKLPWFRVINSQGKISLKGRDLDRQKQKLEAEGIEVSEIGKIALRKYKWQP |||||||||||| ||||||||||||| |||||||||| | ||| |||| |||| |||||||||||||||||||||||||||||||| ..QFLVQIFAVIHQ....KVSTYGEIAKMAG...YARHVGKALG......K.PWF.VINS.GKIS.KGRDLDRQKQKLEAEGIEVSEIGKIALRKYKW --------10--------20--------30--------40--------50--------60--------70--------80--------90-------- -------- LEHHHHHH