Solution structure and backbone dynamics of the permutant P54-55
MDPQGYFLWY QVEMPEDRVN DLARELRIRD NVRRVMVVAS TTPGRYEVNI VLNPNLDQSQ LALEKEIIQR ALENYGARVE KVEELGLRRL AYPIAK
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 89.7 % (1041 of 1160) | 88.5 % (541 of 611) | 89.2 % (398 of 446) | 99.0 % (102 of 103) |
Backbone | 98.1 % (555 of 566) | 99.0 % (189 of 191) | 97.2 % (276 of 284) | 98.9 % (90 of 91) |
Sidechain | 84.1 % (577 of 686) | 83.8 % (352 of 420) | 83.9 % (213 of 254) | 100.0 % (12 of 12) |
Aromatic | 29.0 % (18 of 62) | 41.9 % (13 of 31) | 13.3 % (4 of 30) | 100.0 % (1 of 1) |
Methyl | 98.4 % (120 of 122) | 98.4 % (60 of 61) | 98.4 % (60 of 61) |
1. permutant P54-55
MDPQGYFLWY QVEMPEDRVN DLARELRIRD NVRRVMVVAS TTPGRYEVNI VLNPNLDQSQ LALEKEIIQR ALENYGARVE KVEELGLRRL AYPIAKSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-15N] | 0.8 ~ 1.2 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | natural abundance | 5 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | entity | natural abundance | 0.8 ~ 1.2 mM | |
7 | sodium chloride | natural abundance | 50 mM | |
8 | D2O | natural abundance | 100 % |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | entity | [U-13C; U-15N] | 0.8 ~ 1.2 mM | |
10 | MES | natural abundance | 20 mM | |
11 | sodium chloride | natural abundance | 50 mM | |
12 | H2O | natural abundance | 95 % | |
13 | D2O | natural abundance | 5 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker DRX - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | entity | [U-13C; U-15N] | 0.8 ~ 1.2 mM | |
10 | MES | natural abundance | 20 mM | |
11 | sodium chloride | natural abundance | 50 mM | |
12 | H2O | natural abundance | 95 % | |
13 | D2O | natural abundance | 5 % |
Bruker DRX - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | entity | [U-13C; U-15N] | 0.8 ~ 1.2 mM | |
10 | MES | natural abundance | 20 mM | |
11 | sodium chloride | natural abundance | 50 mM | |
12 | H2O | natural abundance | 95 % | |
13 | D2O | natural abundance | 5 % |
Bruker DRX - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | entity | [U-13C; U-15N] | 0.8 ~ 1.2 mM | |
10 | MES | natural abundance | 20 mM | |
11 | sodium chloride | natural abundance | 50 mM | |
12 | H2O | natural abundance | 95 % | |
13 | D2O | natural abundance | 5 % |
Bruker DRX - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | entity | [U-13C; U-15N] | 0.8 ~ 1.2 mM | |
10 | MES | natural abundance | 20 mM | |
11 | sodium chloride | natural abundance | 50 mM | |
12 | H2O | natural abundance | 95 % | |
13 | D2O | natural abundance | 5 % |
Bruker DRX - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | entity | [U-13C; U-15N] | 0.8 ~ 1.2 mM | |
10 | MES | natural abundance | 20 mM | |
11 | sodium chloride | natural abundance | 50 mM | |
12 | H2O | natural abundance | 95 % | |
13 | D2O | natural abundance | 5 % |
Bruker DRX - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | entity | [U-13C; U-15N] | 0.8 ~ 1.2 mM | |
10 | MES | natural abundance | 20 mM | |
11 | sodium chloride | natural abundance | 50 mM | |
12 | H2O | natural abundance | 95 % | |
13 | D2O | natural abundance | 5 % |
Bruker DRX - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | entity | [U-13C; U-15N] | 0.8 ~ 1.2 mM | |
10 | MES | natural abundance | 20 mM | |
11 | sodium chloride | natural abundance | 50 mM | |
12 | H2O | natural abundance | 95 % | |
13 | D2O | natural abundance | 5 % |
Bruker DRX - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | entity | [U-13C; U-15N] | 0.8 ~ 1.2 mM | |
10 | MES | natural abundance | 20 mM | |
11 | sodium chloride | natural abundance | 50 mM | |
12 | H2O | natural abundance | 95 % | |
13 | D2O | natural abundance | 5 % |
Bruker DRX - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | entity | [U-13C; U-15N] | 0.8 ~ 1.2 mM | |
10 | MES | natural abundance | 20 mM | |
11 | sodium chloride | natural abundance | 50 mM | |
12 | H2O | natural abundance | 95 % | |
13 | D2O | natural abundance | 5 % |
Bruker DRX - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | entity | [U-13C; U-15N] | 0.8 ~ 1.2 mM | |
10 | MES | natural abundance | 20 mM | |
11 | sodium chloride | natural abundance | 50 mM | |
12 | H2O | natural abundance | 95 % | |
13 | D2O | natural abundance | 5 % |
Bruker DRX - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-15N] | 0.8 ~ 1.2 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | natural abundance | 5 % |
Bruker DRX - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-15N] | 0.8 ~ 1.2 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | natural abundance | 5 % |
Bruker DRX - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-15N] | 0.8 ~ 1.2 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | natural abundance | 5 % |
Bruker DRX - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-15N] | 0.8 ~ 1.2 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | natural abundance | 5 % |
Bruker DRX - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | entity | natural abundance | 0.8 ~ 1.2 mM | |
7 | sodium chloride | natural abundance | 50 mM | |
8 | D2O | natural abundance | 100 % |
Bruker DRX - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | entity | natural abundance | 0.8 ~ 1.2 mM | |
7 | sodium chloride | natural abundance | 50 mM | |
8 | D2O | natural abundance | 100 % |
Bruker DRX - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | entity | natural abundance | 0.8 ~ 1.2 mM | |
7 | sodium chloride | natural abundance | 50 mM | |
8 | D2O | natural abundance | 100 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_16345_2kjw.nef |
Input source #2: Coordindates | 2kjw.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90------ MDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVASTTPGRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVASTTPGRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAK
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 96 | 0 | 0 | 100.0 |
Content subtype: combined_16345_2kjw.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90------ MDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVASTTPGRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVASTTPGRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAK
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
65 | LYS | HZ1 | 9.049 |
65 | LYS | HZ2 | 9.049 |
65 | LYS | HZ3 | 9.049 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 611 | 536 | 87.7 |
13C chemical shifts | 446 | 393 | 88.1 |
15N chemical shifts | 114 | 104 | 91.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 191 | 189 | 99.0 |
13C chemical shifts | 192 | 185 | 96.4 |
15N chemical shifts | 91 | 90 | 98.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 420 | 347 | 82.6 |
13C chemical shifts | 254 | 208 | 81.9 |
15N chemical shifts | 23 | 14 | 60.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 64 | 60 | 93.8 |
13C chemical shifts | 64 | 60 | 93.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 31 | 13 | 41.9 |
13C chemical shifts | 30 | 0 | 0.0 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90------ MDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVASTTPGRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAK ||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||| MDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVASTTPGRYEVNIVLN.NLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLA --------10--------20--------30--------40--------50--------60--------70--------80--------90-
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90------ MDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVASTTPGRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVASTTPGRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAK