Solution NMR Structure of the Ig-like C2-type 2 Domain of Human Myotilin. Northeast Structural Genomics Target HR3158.
MGHHHHHHSH EHKRAPMFIY KPQSKKVLEG DSVKLECQIS AIPPPKLFWK RNNEMVQFNT DRISLYQDNT GRVTLLIKDV NKKDAGWYTV SAVNEAGVTT CNTRLDVTAR PNQTLP
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 87.0 % (1201 of 1380) | 85.3 % (616 of 722) | 88.2 % (471 of 534) | 91.9 % (114 of 124) |
Backbone | 91.2 % (622 of 682) | 90.4 % (208 of 230) | 91.5 % (314 of 343) | 91.7 % (100 of 109) |
Sidechain | 84.2 % (681 of 809) | 82.9 % (408 of 492) | 85.8 % (259 of 302) | 93.3 % (14 of 15) |
Aromatic | 72.7 % (80 of 110) | 72.7 % (40 of 55) | 73.6 % (39 of 53) | 50.0 % (1 of 2) |
Methyl | 96.6 % (114 of 118) | 96.6 % (57 of 59) | 96.6 % (57 of 59) |
1. Ig-like C2-type 2 Domain
MGHHHHHHSH EHKRAPMFIY KPQSKKVLEG DSVKLECQIS AIPPPKLFWK RNNEMVQFNT DRISLYQDNT GRVTLLIKDV NKKDAGWYTV SAVNEAGVTT CNTRLDVTAR PNQTLPSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.87 mM | |
2 | sodium chloride | natural abundance | 200 mM | |
3 | MES | natural abundance | 20 mM | |
4 | DSS | natural abundance | 50 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | Calcium Chloride | natural abundance | 5 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | entity | [U-5% 13C] | 0.68 mM | |
11 | sodium chloride | natural abundance | 200 mM | |
12 | MES | natural abundance | 20 mM | |
13 | DSS | natural abundance | 50 uM | |
14 | DTT | natural abundance | 10 mM | |
15 | sodium azide | natural abundance | 0.02 % | |
16 | Calcium Chloride | natural abundance | 5 mM | |
17 | H2O | natural abundance | 90 % | |
18 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker Avance - 800 MHz 5mm Cryoprobe Equipped
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.87 mM | |
2 | sodium chloride | natural abundance | 200 mM | |
3 | MES | natural abundance | 20 mM | |
4 | DSS | natural abundance | 50 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | Calcium Chloride | natural abundance | 5 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz 5mm Cryoprobe Equipped
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.87 mM | |
2 | sodium chloride | natural abundance | 200 mM | |
3 | MES | natural abundance | 20 mM | |
4 | DSS | natural abundance | 50 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | Calcium Chloride | natural abundance | 5 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz 5mm Cryoprobe Equipped
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.87 mM | |
2 | sodium chloride | natural abundance | 200 mM | |
3 | MES | natural abundance | 20 mM | |
4 | DSS | natural abundance | 50 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | Calcium Chloride | natural abundance | 5 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz 5mm Cryoprobe Equipped
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.87 mM | |
2 | sodium chloride | natural abundance | 200 mM | |
3 | MES | natural abundance | 20 mM | |
4 | DSS | natural abundance | 50 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | Calcium Chloride | natural abundance | 5 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz 5mm Cryoprobe Equipped
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.87 mM | |
2 | sodium chloride | natural abundance | 200 mM | |
3 | MES | natural abundance | 20 mM | |
4 | DSS | natural abundance | 50 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | Calcium Chloride | natural abundance | 5 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz 5mm Cryoprobe Equipped
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.87 mM | |
2 | sodium chloride | natural abundance | 200 mM | |
3 | MES | natural abundance | 20 mM | |
4 | DSS | natural abundance | 50 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | Calcium Chloride | natural abundance | 5 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz 1.7 mm MicroCryoprobe Equipped
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.87 mM | |
2 | sodium chloride | natural abundance | 200 mM | |
3 | MES | natural abundance | 20 mM | |
4 | DSS | natural abundance | 50 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | Calcium Chloride | natural abundance | 5 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz 1.7 mm MicroCryoprobe Equipped
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.87 mM | |
2 | sodium chloride | natural abundance | 200 mM | |
3 | MES | natural abundance | 20 mM | |
4 | DSS | natural abundance | 50 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | Calcium Chloride | natural abundance | 5 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz 1.7 mm MicroCryoprobe Equipped
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.87 mM | |
2 | sodium chloride | natural abundance | 200 mM | |
3 | MES | natural abundance | 20 mM | |
4 | DSS | natural abundance | 50 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | Calcium Chloride | natural abundance | 5 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz 5mm Cryoprobe Equipped
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.87 mM | |
2 | sodium chloride | natural abundance | 200 mM | |
3 | MES | natural abundance | 20 mM | |
4 | DSS | natural abundance | 50 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | Calcium Chloride | natural abundance | 5 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz 1.7 mm MicroCryoprobe Equipped
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.87 mM | |
2 | sodium chloride | natural abundance | 200 mM | |
3 | MES | natural abundance | 20 mM | |
4 | DSS | natural abundance | 50 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | Calcium Chloride | natural abundance | 5 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz 1.7 mm MicroCryoprobe Equipped
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.87 mM | |
2 | sodium chloride | natural abundance | 200 mM | |
3 | MES | natural abundance | 20 mM | |
4 | DSS | natural abundance | 50 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | Calcium Chloride | natural abundance | 5 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz 1.7 mm MicroCryoprobe Equipped
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | entity | [U-5% 13C] | 0.68 mM | |
11 | sodium chloride | natural abundance | 200 mM | |
12 | MES | natural abundance | 20 mM | |
13 | DSS | natural abundance | 50 uM | |
14 | DTT | natural abundance | 10 mM | |
15 | sodium azide | natural abundance | 0.02 % | |
16 | Calcium Chloride | natural abundance | 5 mM | |
17 | H2O | natural abundance | 90 % | |
18 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz 1.7 mm MicroCryoprobe Equipped
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | entity | [U-5% 13C] | 0.68 mM | |
11 | sodium chloride | natural abundance | 200 mM | |
12 | MES | natural abundance | 20 mM | |
13 | DSS | natural abundance | 50 uM | |
14 | DTT | natural abundance | 10 mM | |
15 | sodium azide | natural abundance | 0.02 % | |
16 | Calcium Chloride | natural abundance | 5 mM | |
17 | H2O | natural abundance | 90 % | |
18 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz 1.7 mm MicroCryoprobe Equipped
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | entity | [U-5% 13C] | 0.68 mM | |
11 | sodium chloride | natural abundance | 200 mM | |
12 | MES | natural abundance | 20 mM | |
13 | DSS | natural abundance | 50 uM | |
14 | DTT | natural abundance | 10 mM | |
15 | sodium azide | natural abundance | 0.02 % | |
16 | Calcium Chloride | natural abundance | 5 mM | |
17 | H2O | natural abundance | 90 % | |
18 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz 1.7 mm MicroCryoprobe Equipped
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | entity | [U-5% 13C] | 0.68 mM | |
11 | sodium chloride | natural abundance | 200 mM | |
12 | MES | natural abundance | 20 mM | |
13 | DSS | natural abundance | 50 uM | |
14 | DTT | natural abundance | 10 mM | |
15 | sodium azide | natural abundance | 0.02 % | |
16 | Calcium Chloride | natural abundance | 5 mM | |
17 | H2O | natural abundance | 90 % | |
18 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_16370_2kkq.nef |
Input source #2: Coordindates | 2kkq.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGHHHHHHSHEHKRAPMFIYKPQSKKVLEGDSVKLECQISAIPPPKLFWKRNNEMVQFNTDRISLYQDNTGRVTLLIKDVNKKDAGWYTVSAVNEAGVTT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGHHHHHHSHEHKRAPMFIYKPQSKKVLEGDSVKLECQISAIPPPKLFWKRNNEMVQFNTDRISLYQDNTGRVTLLIKDVNKKDAGWYTVSAVNEAGVTT -------110------ CNTRLDVTARPNQTLP |||||||||||||||| CNTRLDVTARPNQTLP
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 116 | 0 | 0 | 100.0 |
Content subtype: combined_16370_2kkq.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGHHHHHHSHEHKRAPMFIYKPQSKKVLEGDSVKLECQISAIPPPKLFWKRNNEMVQFNTDRISLYQDNTGRVTLLIKDVNKKDAGWYTVSAVNEAGVTT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..........EHKRAPMFIYKPQSKKVLEGDSVKLECQISAIPPPKLFWKRNNEMVQFNTDRISLYQDNTGRVTLLIKDVNKKDAGWYTVSAVNEAGVTT -------110------ CNTRLDVTARPNQTLP |||||||||||||||| CNTRLDVTARPNQTLP
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 722 | 608 | 84.2 |
13C chemical shifts | 534 | 458 | 85.8 |
15N chemical shifts | 130 | 113 | 86.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 230 | 207 | 90.0 |
13C chemical shifts | 232 | 208 | 89.7 |
15N chemical shifts | 109 | 98 | 89.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 492 | 401 | 81.5 |
13C chemical shifts | 302 | 250 | 82.8 |
15N chemical shifts | 21 | 15 | 71.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 62 | 59 | 95.2 |
13C chemical shifts | 62 | 59 | 95.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 55 | 38 | 69.1 |
13C chemical shifts | 53 | 37 | 69.8 |
15N chemical shifts | 2 | 1 | 50.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGHHHHHHSHEHKRAPMFIYKPQSKKVLEGDSVKLECQISAIPPPKLFWKRNNEMVQFNTDRISLYQDNTGRVTLLIKDVNKKDAGWYTVSAVNEAGVTT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..........EHKRAPMFIYKPQSKKVLEGDSVKLECQISAIPPPKLFWKRNNEMVQFNTDRISLYQDNTGRVTLLIKDVNKKDAGWYTVSAVNEAGVTT --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110------ CNTRLDVTARPNQTLP ||||||||||||||| CNTRLDVTARPNQTL -------110-----
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGHHHHHHSHEHKRAPMFIYKPQSKKVLEGDSVKLECQISAIPPPKLFWKRNNEMVQFNTDRISLYQDNTGRVTLLIKDVNKKDAGWYTVSAVNEAGVTT ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .........HEHKRAPMFIYKPQSKKVLEGDSVKLECQISAIPPPKLFWKRNNEMVQFNTDRISLYQDNTGRVTLLIKDVNKKDAGWYTVSAVNEAGVTT --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110------ CNTRLDVTARPNQTLP |||||||||||| CNTRLDVTARPN -------110--