Solution Structure Of Protein DSY2949 From Desulfitobacterium hafniense. Northeast Structural Genomics Consortium Target DhR27
MITLTKKQME EMLAHARQAL PNEACGLLGG RRDGDDRWVE RVYPLNNLDQ SPEHFSMDPR EQLTAVKDMR KNGWVMLGNF HSHPATPARP SAEDKRLAFD PSLSYLIISL AEPQKPVCKS FLIKKDGVDE EEIILKEELE HHHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 88.1 % (1522 of 1728) | 94.9 % (864 of 910) | 76.9 % (515 of 670) | 96.6 % (143 of 148) |
Backbone | 83.1 % (711 of 856) | 96.2 % (278 of 289) | 70.1 % (302 of 431) | 96.3 % (131 of 136) |
Sidechain | 93.4 % (944 of 1011) | 94.4 % (586 of 621) | 91.5 % (346 of 378) | 100.0 % (12 of 12) |
Aromatic | 66.7 % (80 of 120) | 76.7 % (46 of 60) | 55.2 % (32 of 58) | 100.0 % (2 of 2) |
Methyl | 100.0 % (140 of 140) | 100.0 % (70 of 70) | 100.0 % (70 of 70) |
1. DSY2949
MITLTKKQME EMLAHARQAL PNEACGLLGG RRDGDDRWVE RVYPLNNLDQ SPEHFSMDPR EQLTAVKDMR KNGWVMLGNF HSHPATPARP SAEDKRLAFD PSLSYLIISL AEPQKPVCKS FLIKKDGVDE EEIILKEELE HHHHHHSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.9 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | entity | [U-10% 13C; U-100% 15N] | 0.9 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.9 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | entity | [U-10% 13C; U-100% 15N] | 0.9 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.9 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.9 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.9 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.9 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.9 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.9 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_16371_2kks.nef |
Input source #2: Coordindates | 2kks.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MITLTKKQMEEMLAHARQALPNEACGLLGGRRDGDDRWVERVYPLNNLDQSPEHFSMDPREQLTAVKDMRKNGWVMLGNFHSHPATPARPSAEDKRLAFD |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MITLTKKQMEEMLAHARQALPNEACGLLGGRRDGDDRWVERVYPLNNLDQSPEHFSMDPREQLTAVKDMRKNGWVMLGNFHSHPATPARPSAEDKRLAFD -------110-------120-------130-------140------ PSLSYLIISLAEPQKPVCKSFLIKKDGVDEEEIILKEELEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||| PSLSYLIISLAEPQKPVCKSFLIKKDGVDEEEIILKEELEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 146 | 0 | 0 | 100.0 |
Content subtype: combined_16371_2kks.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MITLTKKQMEEMLAHARQALPNEACGLLGGRRDGDDRWVERVYPLNNLDQSPEHFSMDPREQLTAVKDMRKNGWVMLGNFHSHPATPARPSAEDKRLAFD |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MITLTKKQMEEMLAHARQALPNEACGLLGGRRDGDDRWVERVYPLNNLDQSPEHFSMDPREQLTAVKDMRKNGWVMLGNFHSHPATPARPSAEDKRLAFD --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140------ PSLSYLIISLAEPQKPVCKSFLIKKDGVDEEEIILKEELEHHHHHH ||||||||||||||||||||||||||||||||||||||||| PSLSYLIISLAEPQKPVCKSFLIKKDGVDEEEIILKEELEH -------110-------120-------130-------140-
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 910 | 863 | 94.8 |
13C chemical shifts | 670 | 486 | 72.5 |
15N chemical shifts | 157 | 142 | 90.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 289 | 277 | 95.8 |
13C chemical shifts | 292 | 140 | 47.9 |
15N chemical shifts | 136 | 130 | 95.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 621 | 586 | 94.4 |
13C chemical shifts | 378 | 346 | 91.5 |
15N chemical shifts | 21 | 12 | 57.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 76 | 76 | 100.0 |
13C chemical shifts | 76 | 76 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 60 | 46 | 76.7 |
13C chemical shifts | 58 | 32 | 55.2 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MITLTKKQMEEMLAHARQALPNEACGLLGGRRDGDDRWVERVYPLNNLDQSPEHFSMDPREQLTAVKDMRKNGWVMLGNFHSHPATPARPSAEDKRLAFD |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MITLTKKQMEEMLAHARQALPNEACGLLGGRRDGDDRWVERVYPLNNLDQSPEHFSMDPREQLTAVKDMRKNGWVMLGNFHSHPATPARPSAEDKRLAFD --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140------ PSLSYLIISLAEPQKPVCKSFLIKKDGVDEEEIILKEELEHHHHHH ||||||||||||||||||||||||||||||||||||||||| PSLSYLIISLAEPQKPVCKSFLIKKDGVDEEEIILKEELEH -------110-------120-------130-------140-
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MITLTKKQMEEMLAHARQALPNEACGLLGGRRDGDDRWVERVYPLNNLDQSPEHFSMDPREQLTAVKDMRKNGWVMLGNFHSHPATPARPSAEDKRLAFD |||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .ITLTKKQMEEMLAHARQA.PNEACGLLGGRRDGDDRWVERVYPLNNLDQSPEHFSMDPREQLTAVKDMRKNGWVMLGNFHSHPATPARPSAEDKRLAFD -------110-------120-------130-------140------ PSLSYLIISLAEPQKPVCKSFLIKKDGVDEEEIILKEELEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||| PSLSYLIISLAEPQKPVCKSFLIKKDGVDEEEIILKEELEHHHHHH