Solution structure of protein af2351 from Archaeoglobus fulgidus. Northeast Structural Genomics Consortium target AtT9/Ontario Center for Structural Proteomics Target af2351
MSKIVGVTYP IPKRFMDRFF KKGKDVFVKP ATVWKELKPG MKFVFYQSHE DTGFVGEARI KRVVLSENPM QFFETFGDRV FLTKDELKEY MKSQERWGRR RESKKKKLWM AIELEDVKKY DKPIKPKRLV PVGGQYLRE
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 86.9 % (1566 of 1803) | 88.7 % (853 of 962) | 84.6 % (594 of 702) | 85.6 % (119 of 139) |
Backbone | 87.8 % (718 of 818) | 88.2 % (246 of 279) | 88.2 % (360 of 408) | 85.5 % (112 of 131) |
Sidechain | 86.7 % (967 of 1115) | 88.9 % (607 of 683) | 83.3 % (353 of 424) | 87.5 % (7 of 8) |
Aromatic | 68.4 % (130 of 190) | 85.3 % (81 of 95) | 50.0 % (46 of 92) | 100.0 % (3 of 3) |
Methyl | 98.3 % (118 of 120) | 98.3 % (59 of 60) | 98.3 % (59 of 60) |
1. af2351
MSKIVGVTYP IPKRFMDRFF KKGKDVFVKP ATVWKELKPG MKFVFYQSHE DTGFVGEARI KRVVLSENPM QFFETFGDRV FLTKDELKEY MKSQERWGRR RESKKKKLWM AIELEDVKKY DKPIKPKRLV PVGGQYLRESolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | af2351 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | bis-tris | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.01 % | |
5 | benzamidine | natural abundance | 1 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Solvent system 99.9% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | af2351 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
9 | bis-tris | natural abundance | 25 mM | |
10 | sodium chloride | natural abundance | 50 mM | |
11 | sodium azide | natural abundance | 0.01 % | |
12 | benzamidine | natural abundance | 1 mM | |
13 | D2O | natural abundance | 99.9 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
14 | af2351 | [U-7% 13C; U-99% 15N] | 0.5 mM | |
15 | bis-tris | natural abundance | 25 mM | |
16 | sodium chloride | natural abundance | 50 mM | |
17 | sodium azide | natural abundance | 0.01 % | |
18 | benzamidine | natural abundance | 1 mM | |
19 | H2O | natural abundance | 90 % | |
20 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
31P | DSS | methyl protons | 0.0 ppm | null | indirect | 0.4048086 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
31P | DSS | methyl protons | 0.0 ppm | null | indirect | 0.4048086 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
31P | DSS | methyl protons | 0.0 ppm | null | indirect | 0.4048086 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
31P | DSS | methyl protons | 0.0 ppm | null | indirect | 0.4048086 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | af2351 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | bis-tris | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.01 % | |
5 | benzamidine | natural abundance | 1 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | af2351 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | bis-tris | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.01 % | |
5 | benzamidine | natural abundance | 1 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | af2351 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | bis-tris | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.01 % | |
5 | benzamidine | natural abundance | 1 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | af2351 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | bis-tris | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.01 % | |
5 | benzamidine | natural abundance | 1 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | af2351 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | bis-tris | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.01 % | |
5 | benzamidine | natural abundance | 1 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | af2351 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | bis-tris | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.01 % | |
5 | benzamidine | natural abundance | 1 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | af2351 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | bis-tris | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.01 % | |
5 | benzamidine | natural abundance | 1 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | af2351 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | bis-tris | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.01 % | |
5 | benzamidine | natural abundance | 1 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | af2351 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | bis-tris | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.01 % | |
5 | benzamidine | natural abundance | 1 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 99.9% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | af2351 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
9 | bis-tris | natural abundance | 25 mM | |
10 | sodium chloride | natural abundance | 50 mM | |
11 | sodium azide | natural abundance | 0.01 % | |
12 | benzamidine | natural abundance | 1 mM | |
13 | D2O | natural abundance | 99.9 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
14 | af2351 | [U-7% 13C; U-99% 15N] | 0.5 mM | |
15 | bis-tris | natural abundance | 25 mM | |
16 | sodium chloride | natural abundance | 50 mM | |
17 | sodium azide | natural abundance | 0.01 % | |
18 | benzamidine | natural abundance | 1 mM | |
19 | H2O | natural abundance | 90 % | |
20 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_16372_2kku.nef |
Input source #2: Coordindates | 2kku.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
------------------------------10--------20--------30--------40--------50--------60--------70-------- MGSSHHHHHHSSGRENLYFQGHMSKIVGVTYPIPKRFMDRFFKKGKDVFVKPATVWKELKPGMKFVFYQSHEDTGFVGEARIKRVVLSENPMQFFETFGD |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGSSHHHHHHSSGRENLYFQGHMSKIVGVTYPIPKRFMDRFFKKGKDVFVKPATVWKELKPGMKFVFYQSHEDTGFVGEARIKRVVLSENPMQFFETFGD --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 80--------90-------100-------110-------120-------130--------- RVFLTKDELKEYMKSQERWGRRRESKKKKLWMAIELEDVKKYDKPIKPKRLVPVGGQYLRE ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| RVFLTKDELKEYMKSQERWGRRRESKKKKLWMAIELEDVKKYDKPIKPKRLVPVGGQYLRE -------110-------120-------130-------140-------150-------160-
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 161 | 0 | 0 | 100.0 |
Content subtype: combined_16372_2kku.nef
Assigned chemical shifts
------------------------------10--------20--------30--------40--------50--------60--------70-------- MGSSHHHHHHSSGRENLYFQGHMSKIVGVTYPIPKRFMDRFFKKGKDVFVKPATVWKELKPGMKFVFYQSHEDTGFVGEARIKRVVLSENPMQFFETFGD ||||||||||| ||||||||||||||||||||||||||||||||| || ||||||||||||||||||||||||| ......................MSKIVGVTYPI..RFMDRFFKKGKDVFVKPATVWKELKPGMKFVFY..HE...FVGEARIKRVVLSENPMQFFETFGD 80--------90-------100-------110-------120-------130--------- RVFLTKDELKEYMKSQERWGRRRESKKKKLWMAIELEDVKKYDKPIKPKRLVPVGGQYLRE |||||||||||||||||||| || |||||||||||||||||||||||||||||||||||| RVFLTKDELKEYMKSQERWG.RR..KKKKLWMAIELEDVKKYDKPIKPKRLVPVGGQYLRE
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
83 | THR | HG1 | 5.482 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 1089 | 836 | 76.8 |
13C chemical shifts | 797 | 574 | 72.0 |
15N chemical shifts | 175 | 114 | 65.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 326 | 240 | 73.6 |
13C chemical shifts | 322 | 231 | 71.7 |
15N chemical shifts | 153 | 107 | 69.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 763 | 596 | 78.1 |
13C chemical shifts | 475 | 343 | 72.2 |
15N chemical shifts | 22 | 7 | 31.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 69 | 63 | 91.3 |
13C chemical shifts | 69 | 62 | 89.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 118 | 81 | 68.6 |
13C chemical shifts | 115 | 44 | 38.3 |
15N chemical shifts | 3 | 3 | 100.0 |
Distance restraints
------------------------------10--------20--------30--------40--------50--------60--------70-------- MGSSHHHHHHSSGRENLYFQGHMSKIVGVTYPIPKRFMDRFFKKGKDVFVKPATVWKELKPGMKFVFYQSHEDTGFVGEARIKRVVLSENPMQFFETFGD ||||||||||| || ||||||||||||||||| |||||||||||| || ||||||||||||||||||||||||| ......................MSKIVGVTYPI..RF.DRFFKKGKDVFVKPATV.KELKPGMKFVFY..HE...FVGEARIKRVVLSENPMQFFETFGD 80--------90-------100-------110-------120-------130--------- RVFLTKDELKEYMKSQERWGRRRESKKKKLWMAIELEDVKKYDKPIKPKRLVPVGGQYLRE |||||||||||||||||||| || |||||||||||||||||||||||||||||||||||| RVFLTKDELKEYMKSQERWG.RR..KKKKLWMAIELEDVKKYDKPIKPKRLVPVGGQYLRE
Dihedral angle restraints
------------------------------10--------20--------30--------40--------50--------60--------70-------- MGSSHHHHHHSSGRENLYFQGHMSKIVGVTYPIPKRFMDRFFKKGKDVFVKPATVWKELKPGMKFVFYQSHEDTGFVGEARIKRVVLSENPMQFFETFGD |||||||||| ||||||||||| |||||| |||||||| |||||| ||||||||||||||||||||||| ......................MSKIVGVTYP..KRFMDRFFKKG.DVFVKP.TVWKELKP.MKFVFY.........GEARIKRVVLSENPMQFFETFGD 80--------90-------100-------110-------120-------130--------- RVFLTKDELKEYMKSQERWGRRRESKKKKLWMAIELEDVKKYDKPIKPKRLVPVGGQYLRE ||||||||||||||||||| ||||||||||||||||||||||||||| |||| RVFLTKDELKEYMKSQERW..........LWMAIELEDVKKYDKPIKPKRLVPVGG.YLRE