Chemical shift assignment of GtR34C from Geobacillus thermodenitrificans. North East Structural Genomics Consortium Target GtR34C
MNEAKGVYVM SVLPNMPAAG RLEAGDRIAA IDGQPINTSE QIVSYVREKQ AGDRVRVTFI RDRKQHEAEL VLKPFPHHPN QIGLGVTMNE AKGVYVMSVL PNMPAAGRLE AGDRIAAIDG QPINTSEQIV SYVREKQAGD RVRVTFIRDR KQHEAELVLK PFPHHPNQIG LGVT
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 44.6 % (893 of 2004) | 43.7 % (459 of 1050) | 44.2 % (342 of 774) | 51.1 % (92 of 180) |
Backbone | 50.6 % (516 of 1020) | 51.1 % (179 of 350) | 48.8 % (248 of 508) | 54.9 % (89 of 162) |
Sidechain | 39.9 % (456 of 1144) | 40.0 % (280 of 700) | 40.6 % (173 of 426) | 16.7 % (3 of 18) |
Aromatic | 24.0 % (23 of 96) | 35.4 % (17 of 48) | 12.5 % (6 of 48) | |
Methyl | 45.6 % (93 of 204) | 46.1 % (47 of 102) | 45.1 % (46 of 102) |
1. GtR34C
MNEAKGVYVM SVLPNMPAAG RLEAGDRIAA IDGQPINTSE QIVSYVREKQ AGDRVRVTFI RDRKQHEAEL VLKPFPHHPN QIGLGVTMNE AKGVYVMSVL PNMPAAGRLE AGDRIAAIDG QPINTSEQIV SYVREKQAGD RVRVTFIRDR KQHEAELVLK PFPHHPNQIG LGVTSolvent system 95% H2O/5% D2O, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | GtR34C | [U-100% 13C; U-100% 15N] | 1.14 mM | |
2 | sodium azide | natural abundance | 2 % | |
3 | DTT | natural abundance | 10 mM | |
4 | CaCl | natural abundance | 5 mM | |
5 | sodium chloride | natural abundance | 200 mM | |
6 | MES | natural abundance | 20 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Solvent system 95% H2O/5% D2O, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | GtR34C | [U-100% 13C; U-100% 15N] | 1.14 mM | |
10 | sodium azide | natural abundance | 2 % | |
11 | DTT | natural abundance | 10 mM | |
12 | CaCl | natural abundance | 5 mM | |
13 | sodium chloride | natural abundance | 200 mM | |
14 | MES | natural abundance | 20 mM | |
15 | C12E5 PEG/Hexanol | natural abundance | 4.2 % | |
16 | H2O | natural abundance | 95 % | |
17 | D2O | natural abundance | 5 % |
Solvent system 95% H2O/5% D2O, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
18 | GtR34C | [U-100% 13C; U-100% 15N] | 1.14 mM | |
19 | sodium azide | natural abundance | 2 % | |
20 | DTT | natural abundance | 10 mM | |
21 | CaCl | natural abundance | 5 mM | |
22 | sodium chloride | natural abundance | 200 mM | |
23 | MES | natural abundance | 20 mM | |
24 | Negatively Charged Compressed Polyacrylamide Gel | natural abundance | 7 % | |
25 | H2O | natural abundance | 95 % | |
26 | D2O | natural abundance | 5 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Temperature 298 K, pH 6.5
Experiment name 2D 15N HSQCTROSY
List #1 PEG_RDC, RDC code DNH, Field strength (1H) 600 MHz
List #2 GEL_RDC, RDC code DNH, Field strength (1H) 600 MHz
Varian INOVA - 600 MHz With Cold Probe
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | GtR34C | [U-100% 13C; U-100% 15N] | 1.14 mM | |
2 | sodium azide | natural abundance | 2 % | |
3 | DTT | natural abundance | 10 mM | |
4 | CaCl | natural abundance | 5 mM | |
5 | sodium chloride | natural abundance | 200 mM | |
6 | MES | natural abundance | 20 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz With Cold Probe
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | GtR34C | [U-100% 13C; U-100% 15N] | 1.14 mM | |
2 | sodium azide | natural abundance | 2 % | |
3 | DTT | natural abundance | 10 mM | |
4 | CaCl | natural abundance | 5 mM | |
5 | sodium chloride | natural abundance | 200 mM | |
6 | MES | natural abundance | 20 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz With Cold Probe
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | GtR34C | [U-100% 13C; U-100% 15N] | 1.14 mM | |
2 | sodium azide | natural abundance | 2 % | |
3 | DTT | natural abundance | 10 mM | |
4 | CaCl | natural abundance | 5 mM | |
5 | sodium chloride | natural abundance | 200 mM | |
6 | MES | natural abundance | 20 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz With Cold Probe
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | GtR34C | [U-100% 13C; U-100% 15N] | 1.14 mM | |
2 | sodium azide | natural abundance | 2 % | |
3 | DTT | natural abundance | 10 mM | |
4 | CaCl | natural abundance | 5 mM | |
5 | sodium chloride | natural abundance | 200 mM | |
6 | MES | natural abundance | 20 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz With Cold Probe
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | GtR34C | [U-100% 13C; U-100% 15N] | 1.14 mM | |
2 | sodium azide | natural abundance | 2 % | |
3 | DTT | natural abundance | 10 mM | |
4 | CaCl | natural abundance | 5 mM | |
5 | sodium chloride | natural abundance | 200 mM | |
6 | MES | natural abundance | 20 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz With Cold Probe
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | GtR34C | [U-100% 13C; U-100% 15N] | 1.14 mM | |
2 | sodium azide | natural abundance | 2 % | |
3 | DTT | natural abundance | 10 mM | |
4 | CaCl | natural abundance | 5 mM | |
5 | sodium chloride | natural abundance | 200 mM | |
6 | MES | natural abundance | 20 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz With Cold Probe
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | GtR34C | [U-100% 13C; U-100% 15N] | 1.14 mM | |
2 | sodium azide | natural abundance | 2 % | |
3 | DTT | natural abundance | 10 mM | |
4 | CaCl | natural abundance | 5 mM | |
5 | sodium chloride | natural abundance | 200 mM | |
6 | MES | natural abundance | 20 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz With Cold Probe
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | GtR34C | [U-100% 13C; U-100% 15N] | 1.14 mM | |
2 | sodium azide | natural abundance | 2 % | |
3 | DTT | natural abundance | 10 mM | |
4 | CaCl | natural abundance | 5 mM | |
5 | sodium chloride | natural abundance | 200 mM | |
6 | MES | natural abundance | 20 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz With Cold Probe
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | GtR34C | [U-100% 13C; U-100% 15N] | 1.14 mM | |
2 | sodium azide | natural abundance | 2 % | |
3 | DTT | natural abundance | 10 mM | |
4 | CaCl | natural abundance | 5 mM | |
5 | sodium chloride | natural abundance | 200 mM | |
6 | MES | natural abundance | 20 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz With Cold Probe
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | GtR34C | [U-100% 13C; U-100% 15N] | 1.14 mM | |
2 | sodium azide | natural abundance | 2 % | |
3 | DTT | natural abundance | 10 mM | |
4 | CaCl | natural abundance | 5 mM | |
5 | sodium chloride | natural abundance | 200 mM | |
6 | MES | natural abundance | 20 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz With Cold Probe
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | GtR34C | [U-100% 13C; U-100% 15N] | 1.14 mM | |
2 | sodium azide | natural abundance | 2 % | |
3 | DTT | natural abundance | 10 mM | |
4 | CaCl | natural abundance | 5 mM | |
5 | sodium chloride | natural abundance | 200 mM | |
6 | MES | natural abundance | 20 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz With Cold Probe
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | GtR34C | [U-100% 13C; U-100% 15N] | 1.14 mM | |
2 | sodium azide | natural abundance | 2 % | |
3 | DTT | natural abundance | 10 mM | |
4 | CaCl | natural abundance | 5 mM | |
5 | sodium chloride | natural abundance | 200 mM | |
6 | MES | natural abundance | 20 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz With Cold Probe
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | GtR34C | [U-100% 13C; U-100% 15N] | 1.14 mM | |
10 | sodium azide | natural abundance | 2 % | |
11 | DTT | natural abundance | 10 mM | |
12 | CaCl | natural abundance | 5 mM | |
13 | sodium chloride | natural abundance | 200 mM | |
14 | MES | natural abundance | 20 mM | |
15 | C12E5 PEG/Hexanol | natural abundance | 4.2 % | |
16 | H2O | natural abundance | 95 % | |
17 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz With Cold Probe
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
18 | GtR34C | [U-100% 13C; U-100% 15N] | 1.14 mM | |
19 | sodium azide | natural abundance | 2 % | |
20 | DTT | natural abundance | 10 mM | |
21 | CaCl | natural abundance | 5 mM | |
22 | sodium chloride | natural abundance | 200 mM | |
23 | MES | natural abundance | 20 mM | |
24 | Negatively Charged Compressed Polyacrylamide Gel | natural abundance | 7 % | |
25 | H2O | natural abundance | 95 % | |
26 | D2O | natural abundance | 5 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_16378_2kl1.nef |
Input source #2: Coordindates | 2kl1.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90---- MNEAKGVYVMSVLPNMPAAGRLEAGDRIAAIDGQPINTSEQIVSYVREKQAGDRVRVTFIRDRKQHEAELVLKPFPHHPNQIGLGVTLEHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MNEAKGVYVMSVLPNMPAAGRLEAGDRIAAIDGQPINTSEQIVSYVREKQAGDRVRVTFIRDRKQHEAELVLKPFPHHPNQIGLGVTLEHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 94 | 0 | 0 | 100.0 |
Content subtype: combined_16378_2kl1.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90---- MNEAKGVYVMSVLPNMPAAGRLEAGDRIAAIDGQPINTSEQIVSYVREKQAGDRVRVTFIRDRKQHEAELVLKPFPHHPNQIGLGVTLEHHHHH |||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||| .NEAKGVYVMSVLPNMPAAGRLEAGDRIAAIDGQPINTSEQIVSYVR.KQAGDRVRVTFIRDRKQHEAELVLKPFPHHPNQIGLGVT --------10--------20--------30--------40--------50--------60--------70--------80-------
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 568 | 435 | 76.6 |
13C chemical shifts | 422 | 324 | 76.8 |
15N chemical shifts | 104 | 76 | 73.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 189 | 165 | 87.3 |
13C chemical shifts | 188 | 162 | 86.2 |
15N chemical shifts | 88 | 75 | 85.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 379 | 270 | 71.2 |
13C chemical shifts | 234 | 162 | 69.2 |
15N chemical shifts | 16 | 1 | 6.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 56 | 44 | 78.6 |
13C chemical shifts | 56 | 42 | 75.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 34 | 17 | 50.0 |
13C chemical shifts | 34 | 6 | 17.6 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90---- MNEAKGVYVMSVLPNMPAAGRLEAGDRIAAIDGQPINTSEQIVSYVREKQAGDRVRVTFIRDRKQHEAELVLKPFPHHPNQIGLGVTLEHHHHH |||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||| ||||||||||| .NEAKGVYVMSVLPNMPAAGRLEAGDRIAAIDGQPINTSEQIVSYVR.KQAGDRVRVTFIRDRKQHEAELVLKPF.HHPNQIGLGVT --------10--------20--------30--------40--------50--------60--------70--------80-------
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90---- MNEAKGVYVMSVLPNMPAAGRLEAGDRIAAIDGQPINTSEQIVSYVREKQAGDRVRVTFIRDRKQHEAELVLKPFPHHPNQIGLGVTLEHHHHH ||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||| .....GVYVMSVLP..PAAGRLEAGDRIAAIDGQPINTSEQIVSYVREKQAGDRVRVTFIRDRKQHEAELVLKPFPHH.NQIGLGVT --------10--------20--------30--------40--------50--------60--------70--------80-------