NMR Solution structure of a diflavin flavoprotein A3 from Nostoc sp. PCC 7120, Northeast Structural Genomics Consortium Target NsR431C
SIGVFYVSEY GYSDRLAQAI INGITKTGVG VDVVDLGAAV DLQELRELVG RCTGLVIGMS PAASAASIQG ALSTILGSVN EKQAVGIFET GGGDDEPIDP LLSKFRNLGL TTAFPAIRIK QTPTENTYKL CEEAGTDLGQ WVTRDRLEHH HHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 93.3 % (1579 of 1692) | 93.3 % (806 of 864) | 92.5 % (618 of 668) | 96.9 % (155 of 160) |
Backbone | 94.7 % (866 of 914) | 96.0 % (308 of 321) | 93.5 % (415 of 444) | 96.0 % (143 of 149) |
Sidechain | 91.4 % (835 of 914) | 90.6 % (492 of 543) | 92.2 % (332 of 360) | 100.0 % (11 of 11) |
Aromatic | 72.2 % (78 of 108) | 72.2 % (39 of 54) | 71.7 % (38 of 53) | 100.0 % (1 of 1) |
Methyl | 100.0 % (202 of 202) | 100.0 % (101 of 101) | 100.0 % (101 of 101) |
1. NsR431C
SIGVFYVSEY GYSDRLAQAI INGITKTGVG VDVVDLGAAV DLQELRELVG RCTGLVIGMS PAASAASIQG ALSTILGSVN EKQAVGIFET GGGDDEPIDP LLSKFRNLGL TTAFPAIRIK QTPTENTYKL CEEAGTDLGQ WVTRDRLEHH HHHHSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details 1.18mM NsR431C, 10mM DTT, 50uM DSS, 0.02% NaN3,200mM NaCl, 5mM CaCl2, 20mM MES, protease inhibitors added.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NsR431C | [U-100% 13C; U-100% 15N] | 1.18 (±0.2) mM | |
2 | DTT | natural abundance | 10 mM | |
3 | DSS | natural abundance | 50 uM | |
4 | NaN3 | natural abundance | 0.02 % | |
5 | NaCl | natural abundance | 200 mM | |
6 | CaCl2 | natural abundance | 5 mM | |
7 | MES | natural abundance | 20 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details 1.18mM NsR431C, 10mM DTT, 50uM DSS, 0.02% NaN3,200mM NaCl, 5mM CaCl2, 20mM MES, protease inhibitors added.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | NsR431C | [U-100% 13C; U-100% 15N] | 1.18 (±0.2) mM | |
11 | DTT | natural abundance | 10 mM | |
12 | DSS | natural abundance | 50 uM | |
13 | NaN3 | natural abundance | 0.02 % | |
14 | NaCl | natural abundance | 200 mM | |
15 | CaCl2 | natural abundance | 5 mM | |
16 | MES | natural abundance | 20 mM | |
17 | D2O | natural abundance | 100 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details 1.18mM NsR431C, 10mM DTT, 50uM DSS, 0.02% NaN3,200mM NaCl, 5mM CaCl2, 20mM MES, protease inhibitors added.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
18 | NsR431C | [U-10% 13C; U-100% 15N] | 1.18 (±0.2) mM | |
19 | DTT | natural abundance | 10 mM | |
20 | DSS | natural abundance | 50 uM | |
21 | NaN3 | natural abundance | 0.02 % | |
22 | NaCl | natural abundance | 200 mM | |
23 | CaCl2 | natural abundance | 5 mM | |
24 | MES | natural abundance | 20 mM | |
25 | D2O | natural abundance | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details 1.18mM NsR431C, 10mM DTT, 50uM DSS, 0.02% NaN3,200mM NaCl, 5mM CaCl2, 20mM MES, protease inhibitors added.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NsR431C | [U-100% 13C; U-100% 15N] | 1.18 (±0.2) mM | |
2 | DTT | natural abundance | 10 mM | |
3 | DSS | natural abundance | 50 uM | |
4 | NaN3 | natural abundance | 0.02 % | |
5 | NaCl | natural abundance | 200 mM | |
6 | CaCl2 | natural abundance | 5 mM | |
7 | MES | natural abundance | 20 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details 1.18mM NsR431C, 10mM DTT, 50uM DSS, 0.02% NaN3,200mM NaCl, 5mM CaCl2, 20mM MES, protease inhibitors added.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NsR431C | [U-100% 13C; U-100% 15N] | 1.18 (±0.2) mM | |
2 | DTT | natural abundance | 10 mM | |
3 | DSS | natural abundance | 50 uM | |
4 | NaN3 | natural abundance | 0.02 % | |
5 | NaCl | natural abundance | 200 mM | |
6 | CaCl2 | natural abundance | 5 mM | |
7 | MES | natural abundance | 20 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details 1.18mM NsR431C, 10mM DTT, 50uM DSS, 0.02% NaN3,200mM NaCl, 5mM CaCl2, 20mM MES, protease inhibitors added.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NsR431C | [U-100% 13C; U-100% 15N] | 1.18 (±0.2) mM | |
2 | DTT | natural abundance | 10 mM | |
3 | DSS | natural abundance | 50 uM | |
4 | NaN3 | natural abundance | 0.02 % | |
5 | NaCl | natural abundance | 200 mM | |
6 | CaCl2 | natural abundance | 5 mM | |
7 | MES | natural abundance | 20 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details 1.18mM NsR431C, 10mM DTT, 50uM DSS, 0.02% NaN3,200mM NaCl, 5mM CaCl2, 20mM MES, protease inhibitors added.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NsR431C | [U-100% 13C; U-100% 15N] | 1.18 (±0.2) mM | |
2 | DTT | natural abundance | 10 mM | |
3 | DSS | natural abundance | 50 uM | |
4 | NaN3 | natural abundance | 0.02 % | |
5 | NaCl | natural abundance | 200 mM | |
6 | CaCl2 | natural abundance | 5 mM | |
7 | MES | natural abundance | 20 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details 1.18mM NsR431C, 10mM DTT, 50uM DSS, 0.02% NaN3,200mM NaCl, 5mM CaCl2, 20mM MES, protease inhibitors added.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NsR431C | [U-100% 13C; U-100% 15N] | 1.18 (±0.2) mM | |
2 | DTT | natural abundance | 10 mM | |
3 | DSS | natural abundance | 50 uM | |
4 | NaN3 | natural abundance | 0.02 % | |
5 | NaCl | natural abundance | 200 mM | |
6 | CaCl2 | natural abundance | 5 mM | |
7 | MES | natural abundance | 20 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details 1.18mM NsR431C, 10mM DTT, 50uM DSS, 0.02% NaN3,200mM NaCl, 5mM CaCl2, 20mM MES, protease inhibitors added.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NsR431C | [U-100% 13C; U-100% 15N] | 1.18 (±0.2) mM | |
2 | DTT | natural abundance | 10 mM | |
3 | DSS | natural abundance | 50 uM | |
4 | NaN3 | natural abundance | 0.02 % | |
5 | NaCl | natural abundance | 200 mM | |
6 | CaCl2 | natural abundance | 5 mM | |
7 | MES | natural abundance | 20 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details 1.18mM NsR431C, 10mM DTT, 50uM DSS, 0.02% NaN3,200mM NaCl, 5mM CaCl2, 20mM MES, protease inhibitors added.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NsR431C | [U-100% 13C; U-100% 15N] | 1.18 (±0.2) mM | |
2 | DTT | natural abundance | 10 mM | |
3 | DSS | natural abundance | 50 uM | |
4 | NaN3 | natural abundance | 0.02 % | |
5 | NaCl | natural abundance | 200 mM | |
6 | CaCl2 | natural abundance | 5 mM | |
7 | MES | natural abundance | 20 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details 1.18mM NsR431C, 10mM DTT, 50uM DSS, 0.02% NaN3,200mM NaCl, 5mM CaCl2, 20mM MES, protease inhibitors added.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NsR431C | [U-100% 13C; U-100% 15N] | 1.18 (±0.2) mM | |
2 | DTT | natural abundance | 10 mM | |
3 | DSS | natural abundance | 50 uM | |
4 | NaN3 | natural abundance | 0.02 % | |
5 | NaCl | natural abundance | 200 mM | |
6 | CaCl2 | natural abundance | 5 mM | |
7 | MES | natural abundance | 20 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details 1.18mM NsR431C, 10mM DTT, 50uM DSS, 0.02% NaN3,200mM NaCl, 5mM CaCl2, 20mM MES, protease inhibitors added.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NsR431C | [U-100% 13C; U-100% 15N] | 1.18 (±0.2) mM | |
2 | DTT | natural abundance | 10 mM | |
3 | DSS | natural abundance | 50 uM | |
4 | NaN3 | natural abundance | 0.02 % | |
5 | NaCl | natural abundance | 200 mM | |
6 | CaCl2 | natural abundance | 5 mM | |
7 | MES | natural abundance | 20 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details 1.18mM NsR431C, 10mM DTT, 50uM DSS, 0.02% NaN3,200mM NaCl, 5mM CaCl2, 20mM MES, protease inhibitors added.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NsR431C | [U-100% 13C; U-100% 15N] | 1.18 (±0.2) mM | |
2 | DTT | natural abundance | 10 mM | |
3 | DSS | natural abundance | 50 uM | |
4 | NaN3 | natural abundance | 0.02 % | |
5 | NaCl | natural abundance | 200 mM | |
6 | CaCl2 | natural abundance | 5 mM | |
7 | MES | natural abundance | 20 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details 1.18mM NsR431C, 10mM DTT, 50uM DSS, 0.02% NaN3,200mM NaCl, 5mM CaCl2, 20mM MES, protease inhibitors added.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
18 | NsR431C | [U-10% 13C; U-100% 15N] | 1.18 (±0.2) mM | |
19 | DTT | natural abundance | 10 mM | |
20 | DSS | natural abundance | 50 uM | |
21 | NaN3 | natural abundance | 0.02 % | |
22 | NaCl | natural abundance | 200 mM | |
23 | CaCl2 | natural abundance | 5 mM | |
24 | MES | natural abundance | 20 mM | |
25 | D2O | natural abundance | 100 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details 1.18mM NsR431C, 10mM DTT, 50uM DSS, 0.02% NaN3,200mM NaCl, 5mM CaCl2, 20mM MES, protease inhibitors added.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
18 | NsR431C | [U-10% 13C; U-100% 15N] | 1.18 (±0.2) mM | |
19 | DTT | natural abundance | 10 mM | |
20 | DSS | natural abundance | 50 uM | |
21 | NaN3 | natural abundance | 0.02 % | |
22 | NaCl | natural abundance | 200 mM | |
23 | CaCl2 | natural abundance | 5 mM | |
24 | MES | natural abundance | 20 mM | |
25 | D2O | natural abundance | 100 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details 1.18mM NsR431C, 10mM DTT, 50uM DSS, 0.02% NaN3,200mM NaCl, 5mM CaCl2, 20mM MES, protease inhibitors added.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | NsR431C | [U-100% 13C; U-100% 15N] | 1.18 (±0.2) mM | |
11 | DTT | natural abundance | 10 mM | |
12 | DSS | natural abundance | 50 uM | |
13 | NaN3 | natural abundance | 0.02 % | |
14 | NaCl | natural abundance | 200 mM | |
15 | CaCl2 | natural abundance | 5 mM | |
16 | MES | natural abundance | 20 mM | |
17 | D2O | natural abundance | 100 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details 1.18mM NsR431C, 10mM DTT, 50uM DSS, 0.02% NaN3,200mM NaCl, 5mM CaCl2, 20mM MES, protease inhibitors added.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | NsR431C | [U-100% 13C; U-100% 15N] | 1.18 (±0.2) mM | |
11 | DTT | natural abundance | 10 mM | |
12 | DSS | natural abundance | 50 uM | |
13 | NaN3 | natural abundance | 0.02 % | |
14 | NaCl | natural abundance | 200 mM | |
15 | CaCl2 | natural abundance | 5 mM | |
16 | MES | natural abundance | 20 mM | |
17 | D2O | natural abundance | 100 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details 1.18mM NsR431C, 10mM DTT, 50uM DSS, 0.02% NaN3,200mM NaCl, 5mM CaCl2, 20mM MES, protease inhibitors added.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | NsR431C | [U-100% 13C; U-100% 15N] | 1.18 (±0.2) mM | |
11 | DTT | natural abundance | 10 mM | |
12 | DSS | natural abundance | 50 uM | |
13 | NaN3 | natural abundance | 0.02 % | |
14 | NaCl | natural abundance | 200 mM | |
15 | CaCl2 | natural abundance | 5 mM | |
16 | MES | natural abundance | 20 mM | |
17 | D2O | natural abundance | 100 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details 1.18mM NsR431C, 10mM DTT, 50uM DSS, 0.02% NaN3,200mM NaCl, 5mM CaCl2, 20mM MES, protease inhibitors added.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NsR431C | [U-100% 13C; U-100% 15N] | 1.18 (±0.2) mM | |
2 | DTT | natural abundance | 10 mM | |
3 | DSS | natural abundance | 50 uM | |
4 | NaN3 | natural abundance | 0.02 % | |
5 | NaCl | natural abundance | 200 mM | |
6 | CaCl2 | natural abundance | 5 mM | |
7 | MES | natural abundance | 20 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_16388_2klb.nef |
Input source #2: Coordindates | 2klb.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 SIGVFYVSEYGYSDRLAQAIINGITKTGVGVDVVDLGAAVDLQELRELVGRCTGLVIGMSPAASAASIQGALSTILGSVNEKQAVGIFETGGGDDEPIDP |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SIGVFYVSEYGYSDRLAQAIINGITKTGVGVDVVDLGAAVDLQELRELVGRCTGLVIGMSPAASAASIQGALSTILGSVNEKQAVGIFETGGGDDEPIDP -------110-------120-------130-------140-------150---- LLSKFRNLGLTTAFPAIRIKQTPTENTYKLCEEAGTDLGQWVTRDRLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||| LLSKFRNLGLTTAFPAIRIKQTPTENTYKLCEEAGTDLGQWVTRDRLEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 154 | 0 | 0 | 100.0 |
Content subtype: combined_16388_2klb.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 SIGVFYVSEYGYSDRLAQAIINGITKTGVGVDVVDLGAAVDLQELRELVGRCTGLVIGMSPAASAASIQGALSTILGSVNEKQAVGIFETGGGDDEPIDP |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SIGVFYVSEYGYSDRLAQAIINGITKTGVGVDVVDLGAAVDLQELRELVGRCTGLVIGMSPAASAASIQGALSTILGSVNEKQAVGIFETGGGDDEPIDP --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150---- LLSKFRNLGLTTAFPAIRIKQTPTENTYKLCEEAGTDLGQWVTRDRLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||| LLSKFRNLGLTTAFPAIRIKQTPTENTYKLCEEAGTDLGQWVTRDRLEHH -------110-------120-------130-------140-------150
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 864 | 810 | 93.8 |
13C chemical shifts | 668 | 612 | 91.6 |
15N chemical shifts | 167 | 154 | 92.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 321 | 309 | 96.3 |
13C chemical shifts | 308 | 280 | 90.9 |
15N chemical shifts | 149 | 142 | 95.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 543 | 501 | 92.3 |
13C chemical shifts | 360 | 332 | 92.2 |
15N chemical shifts | 18 | 12 | 66.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 102 | 102 | 100.0 |
13C chemical shifts | 102 | 102 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 54 | 39 | 72.2 |
13C chemical shifts | 53 | 38 | 71.7 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 SIGVFYVSEYGYSDRLAQAIINGITKTGVGVDVVDLGAAVDLQELRELVGRCTGLVIGMSPAASAASIQGALSTILGSVNEKQAVGIFETGGGDDEPIDP |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SIGVFYVSEYGYSDRLAQAIINGITKTGVGVDVVDLGAAVDLQELRELVGRCTGLVIGMSPAASAASIQGALSTILGSVNEKQAVGIFETGGGDDEPIDP --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150---- LLSKFRNLGLTTAFPAIRIKQTPTENTYKLCEEAGTDLGQWVTRDRLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||| LLSKFRNLGLTTAFPAIRIKQTPTENTYKLCEEAGTDLGQWVTRDRLEHH -------110-------120-------130-------140-------150