SOLUTION STRUCTURE OF GLUTAREDOXIN FROM Bartonella henselae str. Houston. Seattle Structure Genomics Center for Infectious Disease (SSGCID)
ID | Type | Value order | Atom ID 1 | Atom ID 2 |
---|---|---|---|---|
1 | disulfide | sing | 1:CYS16:SG | 1:CYS19:SG |
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 84.1 % (871 of 1036) | 90.4 % (492 of 544) | 72.4 % (289 of 399) | 96.8 % (90 of 93) |
Backbone | 93.2 % (490 of 526) | 92.9 % (169 of 182) | 92.3 % (239 of 259) | 96.5 % (82 of 85) |
Sidechain | 77.2 % (456 of 591) | 89.2 % (323 of 362) | 56.6 % (125 of 221) | 100.0 % (8 of 8) |
Aromatic | 52.9 % (36 of 68) | 94.1 % (32 of 34) | 11.8 % (4 of 34) | |
Methyl | 88.6 % (78 of 88) | 95.5 % (42 of 44) | 81.8 % (36 of 44) |
1. GLUTAREDOXIN
GPGSMKEIIL YTRPNCPYCK RARDLLDKKG VKYTDIDAST SLRQEMVQRA NGRNTFPQIF IGDYHVGGCD DLYALENKGK LDSLLQDVHSolvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 298 K, pH 7 (±0)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 15N] | 0.5 (±0.05) mM | |
2 | potassium phosphate | natural abundance | 100 mM | |
3 | potassium chloride | natural abundance | 10 mM | |
4 | D2O | natural abundance | 8 % | |
5 | H2O | natural abundance | 92 % |
Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 298 K, pH 7 (±0)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | entity | [U-98% 13C; U-98% 15N] | 0.8 (±0.05) mM | |
7 | potassium phosphate | natural abundance | 100 mM | |
8 | potassium chloride | natural abundance | 10 mM | |
9 | D2O | natural abundance | 8 % | |
10 | H2O | natural abundance | 92 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | water | protons | 4.71 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | water | protons | 4.71 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | water | protons | 4.71 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | water | protons | 4.71 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker Avance - 750 MHz
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 298 K, pH 7 (±0)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 15N] | 0.5 (±0.05) mM | |
2 | potassium phosphate | natural abundance | 100 mM | |
3 | potassium chloride | natural abundance | 10 mM | |
4 | D2O | natural abundance | 8 % | |
5 | H2O | natural abundance | 92 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 298 K, pH 7 (±0)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 15N] | 0.5 (±0.05) mM | |
2 | potassium phosphate | natural abundance | 100 mM | |
3 | potassium chloride | natural abundance | 10 mM | |
4 | D2O | natural abundance | 8 % | |
5 | H2O | natural abundance | 92 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 298 K, pH 7 (±0)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 15N] | 0.5 (±0.05) mM | |
2 | potassium phosphate | natural abundance | 100 mM | |
3 | potassium chloride | natural abundance | 10 mM | |
4 | D2O | natural abundance | 8 % | |
5 | H2O | natural abundance | 92 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 298 K, pH 7 (±0)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 15N] | 0.5 (±0.05) mM | |
2 | potassium phosphate | natural abundance | 100 mM | |
3 | potassium chloride | natural abundance | 10 mM | |
4 | D2O | natural abundance | 8 % | |
5 | H2O | natural abundance | 92 % |
Bruker Avance - 750 MHz
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 298 K, pH 7 (±0)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 15N] | 0.5 (±0.05) mM | |
2 | potassium phosphate | natural abundance | 100 mM | |
3 | potassium chloride | natural abundance | 10 mM | |
4 | D2O | natural abundance | 8 % | |
5 | H2O | natural abundance | 92 % |
Bruker Avance - 750 MHz
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 298 K, pH 7 (±0)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 15N] | 0.5 (±0.05) mM | |
2 | potassium phosphate | natural abundance | 100 mM | |
3 | potassium chloride | natural abundance | 10 mM | |
4 | D2O | natural abundance | 8 % | |
5 | H2O | natural abundance | 92 % |
Bruker Avance - 750 MHz
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 298 K, pH 7 (±0)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 15N] | 0.5 (±0.05) mM | |
2 | potassium phosphate | natural abundance | 100 mM | |
3 | potassium chloride | natural abundance | 10 mM | |
4 | D2O | natural abundance | 8 % | |
5 | H2O | natural abundance | 92 % |
Bruker Avance - 750 MHz
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 298 K, pH 7 (±0)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 15N] | 0.5 (±0.05) mM | |
2 | potassium phosphate | natural abundance | 100 mM | |
3 | potassium chloride | natural abundance | 10 mM | |
4 | D2O | natural abundance | 8 % | |
5 | H2O | natural abundance | 92 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 298 K, pH 7 (±0)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 15N] | 0.5 (±0.05) mM | |
2 | potassium phosphate | natural abundance | 100 mM | |
3 | potassium chloride | natural abundance | 10 mM | |
4 | D2O | natural abundance | 8 % | |
5 | H2O | natural abundance | 92 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 298 K, pH 7 (±0)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 15N] | 0.5 (±0.05) mM | |
2 | potassium phosphate | natural abundance | 100 mM | |
3 | potassium chloride | natural abundance | 10 mM | |
4 | D2O | natural abundance | 8 % | |
5 | H2O | natural abundance | 92 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_16403_2klx.nef |
Input source #2: Coordindates | 2klx.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | True (see coordinates for details) |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Ã…) |
---|---|---|---|---|
A:12:CYS:SG | A:15:CYS:SG | unknown, CA 56.277 ppm | reduced, CA 64.573, CB 29.227 ppm | 1.96 |
Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
------------10--------20--------30--------40--------50--------60--------70--------80----- GPGSMKEIILYTRPNCPYCKRARDLLDKKGVKYTDIDASTSLRQEMVQRANGRNTFPQIFIGDYHVGGCDDLYALENKGKLDSLLQDVH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GPGSMKEIILYTRPNCPYCKRARDLLDKKGVKYTDIDASTSLRQEMVQRANGRNTFPQIFIGDYHVGGCDDLYALENKGKLDSLLQDVH --------10--------20--------30--------40--------50--------60--------70--------80---------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 89 | 0 | 0 | 100.0 |
Content subtype: combined_16403_2klx.nef
Assigned chemical shifts
------------10--------20--------30--------40--------50--------60--------70--------80----- GPGSMKEIILYTRPNCPYCKRARDLLDKKGVKYTDIDASTSLRQEMVQRANGRNTFPQIFIGDYHVGGCDDLYALENKGKLDSLLQDVH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .PGSMKEIILYTRPNCPYCKRARDLLDKKGVKYTDIDASTSLRQEMVQRANGRNTFPQIFIGDYHVGGCDDLYALENKGKLDSLLQDVH
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
11 | ASN | CG | 177.745 |
40 | GLN | CD | 179.71 |
47 | ASN | CG | 177.756 |
50 | ASN | CG | 176.435 |
73 | ASN | CG | 177.439 |
82 | GLN | CD | 179.798 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 399 | 275 | 68.9 |
1H chemical shifts | 544 | 498 | 91.5 |
15N chemical shifts | 99 | 90 | 90.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 178 | 162 | 91.0 |
1H chemical shifts | 182 | 174 | 95.6 |
15N chemical shifts | 85 | 82 | 96.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 221 | 113 | 51.1 |
1H chemical shifts | 362 | 324 | 89.5 |
15N chemical shifts | 14 | 8 | 57.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 46 | 33 | 71.7 |
1H chemical shifts | 46 | 45 | 97.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 34 | 4 | 11.8 |
1H chemical shifts | 34 | 32 | 94.1 |
Covalent bonds
Distance restraints
------------10--------20--------30--------40--------50--------60--------70--------80----- GPGSMKEIILYTRPNCPYCKRARDLLDKKGVKYTDIDASTSLRQEMVQRANGRNTFPQIFIGDYHVGGCDDLYALENKGKLDSLLQDVH ||||||||||||| ||||||||||||||||||||||| ||||||||||||||| |||||||||||||||||||||||||||||||| ...SMKEIILYTRPNC.YCKRARDLLDKKGVKYTDIDAST.LRQEMVQRANGRNTF.QIFIGDYHVGGCDDLYALENKGKLDSLLQDVH
Dihedral angle restraints
------------10--------20--------30--------40--------50--------60--------70--------80----- GPGSMKEIILYTRPNCPYCKRARDLLDKKGVKYTDIDASTSLRQEMVQRANGRNTFPQIFIGDYHVGGCDDLYALENKGKLDSLLQDVH |||||||||||||||||||||||||||||||||| |||||||||||| |||||||| ||| ||||||||||| ||||| ....MKEIILYTRPNCPYCKRARDLLDKKGVKYTDIDA.TSLRQEMVQRAN...TFPQIFIG.YHV..CDDLYALENKG.LDSLL ------------10--------20--------30--------40--------50--------60--------70--------80-