The structure of the KlcA and ArdB proteins show a novel fold and antirestriction activity against Type I DNA restriction systems in vivo but not in vitro.
MNTEEQPVTA SLVAEAQRLD FLPTYFGPRL MMRGEALVYA WMRRLCERYN GAYWHYYALS DGGFYMAPDL AGRLEIEVNG NGFRGELSAD AAGIVATLFA LGQLAAEIAD TDAADALIDR YHFLRGFAAG HPEAAAIYRA ID
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 90.1 % (1432 of 1590) | 90.4 % (733 of 811) | 88.2 % (558 of 633) | 96.6 % (141 of 146) |
Backbone | 97.0 % (817 of 842) | 96.2 % (281 of 292) | 97.8 % (404 of 413) | 96.4 % (132 of 137) |
Sidechain | 84.6 % (742 of 877) | 87.1 % (452 of 519) | 80.5 % (281 of 349) | 100.0 % (9 of 9) |
Aromatic | 44.4 % (79 of 178) | 53.9 % (48 of 89) | 33.3 % (29 of 87) | 100.0 % (2 of 2) |
Methyl | 97.6 % (162 of 166) | 97.6 % (81 of 83) | 97.6 % (81 of 83) |
1. KlcA and ArdB proteins
MNTEEQPVTA SLVAEAQRLD FLPTYFGPRL MMRGEALVYA WMRRLCERYN GAYWHYYALS DGGFYMAPDL AGRLEIEVNG NGFRGELSAD AAGIVATLFA LGQLAAEIAD TDAADALIDR YHFLRGFAAG HPEAAAIYRA IDSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.2) K, pH 6.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KlcA | [U-98% 13C; U-98% 15N] | 0.7 mM | |
2 | sodium acetate | [U-100% 2H] | 20 mM | |
3 | sodium azide | natural abundance | 0.05 % | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.2) K, pH 6.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | KlcA | [U-98% 15N] | 0.7 mM | |
7 | sodium acetate | [U-100% 2H] | 20 mM | |
8 | sodium azide | natural abundance | 0.05 % | |
9 | Pf1 phage | natural abundance | 6.25 mg | |
10 | H2O | natural abundance | 90 % | |
11 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.2) K, pH 6.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
12 | KlcA | [U-98% 15N] | 0.7 mM | |
13 | sodium acetate | [U-100% 2H] | 20 mM | |
14 | sodium azide | natural abundance | 0.05 % | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | water | protons | 4.768 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | water | protons | 4.768 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | water | protons | 4.768 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | water | protons | 4.768 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Pressure 1 atm, Temperature 298 (±0.2) K, pH 6.0 (±0.2)
Experiment name IPAP for RDC measurement
List #1 RDC_list_1, RDC code DHN, Field strength (1H) 800.014 MHz
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.2) K, pH 6.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KlcA | [U-98% 13C; U-98% 15N] | 0.7 mM | |
2 | sodium acetate | [U-100% 2H] | 20 mM | |
3 | sodium azide | natural abundance | 0.05 % | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.2) K, pH 6.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KlcA | [U-98% 13C; U-98% 15N] | 0.7 mM | |
2 | sodium acetate | [U-100% 2H] | 20 mM | |
3 | sodium azide | natural abundance | 0.05 % | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.2) K, pH 6.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KlcA | [U-98% 13C; U-98% 15N] | 0.7 mM | |
2 | sodium acetate | [U-100% 2H] | 20 mM | |
3 | sodium azide | natural abundance | 0.05 % | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.2) K, pH 6.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KlcA | [U-98% 13C; U-98% 15N] | 0.7 mM | |
2 | sodium acetate | [U-100% 2H] | 20 mM | |
3 | sodium azide | natural abundance | 0.05 % | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.2) K, pH 6.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KlcA | [U-98% 13C; U-98% 15N] | 0.7 mM | |
2 | sodium acetate | [U-100% 2H] | 20 mM | |
3 | sodium azide | natural abundance | 0.05 % | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.2) K, pH 6.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KlcA | [U-98% 13C; U-98% 15N] | 0.7 mM | |
2 | sodium acetate | [U-100% 2H] | 20 mM | |
3 | sodium azide | natural abundance | 0.05 % | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.2) K, pH 6.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KlcA | [U-98% 13C; U-98% 15N] | 0.7 mM | |
2 | sodium acetate | [U-100% 2H] | 20 mM | |
3 | sodium azide | natural abundance | 0.05 % | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.2) K, pH 6.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KlcA | [U-98% 13C; U-98% 15N] | 0.7 mM | |
2 | sodium acetate | [U-100% 2H] | 20 mM | |
3 | sodium azide | natural abundance | 0.05 % | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.2) K, pH 6.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KlcA | [U-98% 13C; U-98% 15N] | 0.7 mM | |
2 | sodium acetate | [U-100% 2H] | 20 mM | |
3 | sodium azide | natural abundance | 0.05 % | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.2) K, pH 6.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KlcA | [U-98% 13C; U-98% 15N] | 0.7 mM | |
2 | sodium acetate | [U-100% 2H] | 20 mM | |
3 | sodium azide | natural abundance | 0.05 % | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.2) K, pH 6.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KlcA | [U-98% 13C; U-98% 15N] | 0.7 mM | |
2 | sodium acetate | [U-100% 2H] | 20 mM | |
3 | sodium azide | natural abundance | 0.05 % | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.2) K, pH 6.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KlcA | [U-98% 13C; U-98% 15N] | 0.7 mM | |
2 | sodium acetate | [U-100% 2H] | 20 mM | |
3 | sodium azide | natural abundance | 0.05 % | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.2) K, pH 6.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KlcA | [U-98% 13C; U-98% 15N] | 0.7 mM | |
2 | sodium acetate | [U-100% 2H] | 20 mM | |
3 | sodium azide | natural abundance | 0.05 % | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.2) K, pH 6.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KlcA | [U-98% 13C; U-98% 15N] | 0.7 mM | |
2 | sodium acetate | [U-100% 2H] | 20 mM | |
3 | sodium azide | natural abundance | 0.05 % | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.2) K, pH 6.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KlcA | [U-98% 13C; U-98% 15N] | 0.7 mM | |
2 | sodium acetate | [U-100% 2H] | 20 mM | |
3 | sodium azide | natural abundance | 0.05 % | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.2) K, pH 6.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KlcA | [U-98% 13C; U-98% 15N] | 0.7 mM | |
2 | sodium acetate | [U-100% 2H] | 20 mM | |
3 | sodium azide | natural abundance | 0.05 % | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.2) K, pH 6.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
12 | KlcA | [U-98% 15N] | 0.7 mM | |
13 | sodium acetate | [U-100% 2H] | 20 mM | |
14 | sodium azide | natural abundance | 0.05 % | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.2) K, pH 6.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
12 | KlcA | [U-98% 15N] | 0.7 mM | |
13 | sodium acetate | [U-100% 2H] | 20 mM | |
14 | sodium azide | natural abundance | 0.05 % | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.2) K, pH 6.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
12 | KlcA | [U-98% 15N] | 0.7 mM | |
13 | sodium acetate | [U-100% 2H] | 20 mM | |
14 | sodium azide | natural abundance | 0.05 % | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.2) K, pH 6.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | KlcA | [U-98% 15N] | 0.7 mM | |
7 | sodium acetate | [U-100% 2H] | 20 mM | |
8 | sodium azide | natural abundance | 0.05 % | |
9 | Pf1 phage | natural abundance | 6.25 mg | |
10 | H2O | natural abundance | 90 % | |
11 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.2) K, pH 6.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KlcA | [U-98% 13C; U-98% 15N] | 0.7 mM | |
2 | sodium acetate | [U-100% 2H] | 20 mM | |
3 | sodium azide | natural abundance | 0.05 % | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_16428_2kmg.nef |
Input source #2: Coordindates | 2kmg.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MNTEEQPVTASLVAEAQRLDFLPTYFGPRLMMRGEALVYAWMRRLCERYNGAYWHYYALSDGGFYMAPDLAGRLEIEVNGNGFRGELSADAAGIVATLFA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MNTEEQPVTASLVAEAQRLDFLPTYFGPRLMMRGEALVYAWMRRLCERYNGAYWHYYALSDGGFYMAPDLAGRLEIEVNGNGFRGELSADAAGIVATLFA -------110-------120-------130-------140-- LGQLAAEIADTDAADALIDRYHFLRGFAAGHPEAAAIYRAID |||||||||||||||||||||||||||||||||||||||||| LGQLAAEIADTDAADALIDRYHFLRGFAAGHPEAAAIYRAID
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 142 | 0 | 0 | 100.0 |
Content subtype: combined_16428_2kmg.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MNTEEQPVTASLVAEAQRLDFLPTYFGPRLMMRGEALVYAWMRRLCERYNGAYWHYYALSDGGFYMAPDLAGRLEIEVNGNGFRGELSADAAGIVATLFA ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .NTEEQPVTASLVAEAQRLDFLPTYFGPRLMMRGEALVYAWMRRLCERYNGAYWHYYALSDGGFYMAPDLAGRLEIEVNGNGFRGELSADAAGIVATLFA -------110-------120-------130-------140-- LGQLAAEIADTDAADALIDRYHFLRGFAAGHPEAAAIYRAID |||||||| |||||||||||||||||||||||||||||||| LGQLAAEI..TDAADALIDRYHFLRGFAAGHPEAAAIYRAID
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
2 | ASN | CG | 176.894 |
6 | GLN | CD | 180.63 |
17 | GLN | CD | 180.621 |
50 | ASN | CG | 177.677 |
79 | ASN | CG | 176.238 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 811 | 731 | 90.1 |
13C chemical shifts | 633 | 554 | 87.5 |
15N chemical shifts | 157 | 149 | 94.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 292 | 283 | 96.9 |
13C chemical shifts | 284 | 277 | 97.5 |
15N chemical shifts | 137 | 131 | 95.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 519 | 448 | 86.3 |
13C chemical shifts | 349 | 277 | 79.4 |
15N chemical shifts | 20 | 18 | 90.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 88 | 83 | 94.3 |
13C chemical shifts | 88 | 83 | 94.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 89 | 40 | 44.9 |
13C chemical shifts | 87 | 26 | 29.9 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MNTEEQPVTASLVAEAQRLDFLPTYFGPRLMMRGEALVYAWMRRLCERYNGAYWHYYALSDGGFYMAPDLAGRLEIEVNGNGFRGELSADAAGIVATLFA ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .NTEEQPVTASLVAEAQRLDFLPTYFGPRLMMRGEALVYAWMRRLCERYNGAYWHYYALSDGGFYMAPDLAGRLEIEVNGNGFRGELSADAAGIVATLFA -------110-------120-------130-------140-- LGQLAAEIADTDAADALIDRYHFLRGFAAGHPEAAAIYRAID |||||||| ||||||||||||||||||||||||||||||| LGQLAAEI...DAADALIDRYHFLRGFAAGHPEAAAIYRAID
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MNTEEQPVTASLVAEAQRLDFLPTYFGPRLMMRGEALVYAWMRRLCERYNGAYWHYYALSDGGFYMAPDLAGRLEIEVNGNGFRGELSADAAGIVATLFA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||| ....EQPVTASLVAEAQRLDFLPTYFGPRLMMRGEALVYAWMRRLCERYNGAYWHYYALSDG..YMAPDLAGRLEIEVNGNGFRGELSADAAGIVATLFA -------110-------120-------130-------140-- LGQLAAEIADTDAADALIDRYHFLRGFAAGHPEAAAIYRAID ||||||||| |||||||||||||||||||||||||||||||| LGQLAAEIA.TDAADALIDRYHFLRGFAAGHPEAAAIYRAID