NMR Solution Structure of SH2 Domain of the Human Tensin Like C1 Domain Containing Phosphatase (TENC1)
MHHHHHHSSG LVPRGSDTSK FWYKPHLSRD QAIALLKDKD PGAFLIRDSH SFQGAYGLAL KVATPPPSAQ PWKGDPVEQL VRHFLIETGP KGVKIKGCPS EPYFGSLSAL VSQHSISPIS LPCCLRIPSK D
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 74.5 % (1135 of 1524) | 84.1 % (670 of 797) | 59.2 % (357 of 603) | 87.1 % (108 of 124) |
Backbone | 74.7 % (566 of 758) | 89.9 % (232 of 258) | 59.5 % (228 of 383) | 90.6 % (106 of 117) |
Sidechain | 76.3 % (677 of 887) | 81.3 % (438 of 539) | 69.5 % (237 of 341) | 28.6 % (2 of 7) |
Aromatic | 31.2 % (43 of 138) | 59.4 % (41 of 69) | 0.0 % (0 of 67) | 100.0 % (2 of 2) |
Methyl | 96.8 % (122 of 126) | 96.8 % (61 of 63) | 96.8 % (61 of 63) |
1. SH2 Domain
MHHHHHHSSG LVPRGSDTSK FWYKPHLSRD QAIALLKDKD PGAFLIRDSH SFQGAYGLAL KVATPPPSAQ PWKGDPVEQL VRHFLIETGP KGVKIKGCPS EPYFGSLSAL VSQHSISPIS LPCCLRIPSK DSolvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SH2 | [U-100% 13C] | 1 mM | |
2 | sodium acetate | natural abundance | 100 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | D2O | natural abundance | 100 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | SH2 | [U-100% 15N] | 1 mM | |
6 | sodium acetate | natural abundance | 100 mM | |
7 | sodium chloride | natural abundance | 100 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | SH2 | [U-100% 13C; U-100% 15N] | 1 mM | |
11 | sodium acetate | natural abundance | 100 mM | |
12 | sodium chloride | natural abundance | 100 mM | |
13 | H2O | natural abundance | 90 % | |
14 | D2O | natural abundance | 10 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | SH2 | natural abundance | 1 mM | |
16 | sodium acetate | natural abundance | 100 mM | |
17 | sodium chloride | natural abundance | 100 mM | |
18 | D2O | natural abundance | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian INOVA - 750 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SH2 | [U-100% 13C] | 1 mM | |
2 | sodium acetate | natural abundance | 100 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | D2O | natural abundance | 100 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | SH2 | [U-100% 15N] | 1 mM | |
6 | sodium acetate | natural abundance | 100 mM | |
7 | sodium chloride | natural abundance | 100 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | SH2 | natural abundance | 1 mM | |
16 | sodium acetate | natural abundance | 100 mM | |
17 | sodium chloride | natural abundance | 100 mM | |
18 | D2O | natural abundance | 100 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | SH2 | [U-100% 13C; U-100% 15N] | 1 mM | |
11 | sodium acetate | natural abundance | 100 mM | |
12 | sodium chloride | natural abundance | 100 mM | |
13 | H2O | natural abundance | 90 % | |
14 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | SH2 | [U-100% 13C; U-100% 15N] | 1 mM | |
11 | sodium acetate | natural abundance | 100 mM | |
12 | sodium chloride | natural abundance | 100 mM | |
13 | H2O | natural abundance | 90 % | |
14 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | SH2 | [U-100% 13C; U-100% 15N] | 1 mM | |
11 | sodium acetate | natural abundance | 100 mM | |
12 | sodium chloride | natural abundance | 100 mM | |
13 | H2O | natural abundance | 90 % | |
14 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SH2 | [U-100% 13C] | 1 mM | |
2 | sodium acetate | natural abundance | 100 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | D2O | natural abundance | 100 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SH2 | [U-100% 13C] | 1 mM | |
2 | sodium acetate | natural abundance | 100 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | D2O | natural abundance | 100 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | SH2 | [U-100% 15N] | 1 mM | |
6 | sodium acetate | natural abundance | 100 mM | |
7 | sodium chloride | natural abundance | 100 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_16472_2kno.nef |
Input source #2: Coordindates | 2kno.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MHHHHHHSSGLVPRGSDTSKFWYKPHLSRDQAIALLKDKDPGAFLIRDSHSFQGAYGLALKVATPPPSAQPWKGDPVEQLVRHFLIETGPKGVKIKGCPS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MHHHHHHSSGLVPRGSDTSKFWYKPHLSRDQAIALLKDKDPGAFLIRDSHSFQGAYGLALKVATPPPSAQPWKGDPVEQLVRHFLIETGPKGVKIKGCPS -------110-------120-------130- EPYFGSLSALVSQHSISPISLPCCLRIPSKD ||||||||||||||||||||||||||||||| EPYFGSLSALVSQHSISPISLPCCLRIPSKD
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 131 | 0 | 0 | 100.0 |
Content subtype: combined_16472_2kno.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MHHHHHHSSGLVPRGSDTSKFWYKPHLSRDQAIALLKDKDPGAFLIRDSHSFQGAYGLALKVATPPPSAQPWKGDPVEQLVRHFLIETGPKGVKIKGCPS ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .............RGSDTSKFWYKPHLSRDQAIALLKDKDPGAFLIRDSHSFQGAYGLALKVATPPPSAQPWKGDPVEQLVRHFLIETGPKGVKIKGCPS -------110-------120-------130- EPYFGSLSALVSQHSISPISLPCCLRIPSKD |||||||||||| |||||||||||||||||| EPYFGSLSALVS.HSISPISLPCCLRIPSKD
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 797 | 655 | 82.2 |
13C chemical shifts | 603 | 337 | 55.9 |
15N chemical shifts | 129 | 103 | 79.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 258 | 226 | 87.6 |
13C chemical shifts | 262 | 106 | 40.5 |
15N chemical shifts | 117 | 101 | 86.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 539 | 429 | 79.6 |
13C chemical shifts | 341 | 231 | 67.7 |
15N chemical shifts | 12 | 2 | 16.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 64 | 59 | 92.2 |
13C chemical shifts | 64 | 59 | 92.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 69 | 41 | 59.4 |
13C chemical shifts | 67 | 0 | 0.0 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MHHHHHHSSGLVPRGSDTSKFWYKPHLSRDQAIALLKDKDPGAFLIRDSHSFQGAYGLALKVATPPPSAQPWKGDPVEQLVRHFLIETGPKGVKIKGCPS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..............GSDTSKFWYKPHLSRDQAIALLKDKDPGAFLIRDSHSFQGAYGLALKVATPPPSAQPWKGDPVEQLVRHFLIETGPKGVKIKGCPS -------110-------120-------130- EPYFGSLSALVSQHSISPISLPCCLRIPSKD |||||||||||| |||||||||||||||||| EPYFGSLSALVS.HSISPISLPCCLRIPSKD
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MHHHHHHSSGLVPRGSDTSKFWYKPHLSRDQAIALLKDKDPGAFLIRDSHSFQGAYGLALKVATPPPSAQPWKGDPVEQLVRHFLIETGPKGVKIKGCPS ||||||||||||||||||||| ||||||| |||||||||||| ||| |||||||||||||| |||||||| ..................SKFWYKPHLSRDQAIALLKDK..GAFLIRD...FQGAYGLALKVA.....AQP....PVEQLVRHFLIETG..GVKIKGCP. -------110-------120-------130- EPYFGSLSALVSQHSISPISLPCCLRIPSKD |||||||| ||| |||||| .....SLSALVSQ.....ISL....RIPSKD